• Gene id: 51773

Gene Summary

• Gene Symbol: RSF1   Gene   UCSC   Ensembl
• Aliases: HBXAP, RSF-1, XAP8, p325
• Gene name: remodeling and spacing factor 1
• Alternate names: remodeling and spacing factor 1, HBV pX-associated protein 8, hepatitis B virus x-associated protein, p325 subunit of RSF chromatin-remodeling complex,
• Gene location: 11q14.1 (77872231: 77660008)     Exons: 17     NC_000011.10
• Gene summary(Entrez): This gene encodes a nuclear protein that interacts with hepatitis B virus X protein (HBX) and facilitates transcription of hepatitis B virus genes by the HBX transcription activator, suggesting a role for this interaction in the virus life cycle. This pro
• OMIM: 608522

Protein Summary

• Protein general information: Q96T23  
  • Name: Remodeling and spacing factor 1 (Rsf 1) (HBV pX associated protein 8) (Hepatitis B virus X associated protein) (p325 subunit of RSF chromatin remodeling complex)
  • Length: 1441  
  • Mass: 163821
  • Tissue specificity: Ubiquitously expressed.
• Sequence:

  MATAAAAAAVMAPPGCPGSCPNFAVVCSFLERYGPLLDLPELPFPELERVLQAPPPDVGNGEVPKELVELHLKLM
  RKIGKSVTADRWEKYLIKICQEFNSTWAWEMEKKGYLEMSVECKLALLKYLCECQFDDNLKFKNIINEEDADTMR
  LQPIGRDKDGLMYWYQLDQDHNVRMYIEEQDDQDGSSWKCIVRNRNELAETLALLKAQIDPVLLKNSSQQDNSSR
  ESPSLEDEETKKEEETPKQEEQKESEKMKSEEQPMDLENRSTANVLEETTVKKEKEDEKELVKLPVIVKLEKPLP
  ENEEKKIIKEESDSFKENVKPIKVEVKECRADPKDTKSSMEKPVAQEPERIEFGGNIKSSHEITEKSTEETEKLK
  NDQQAKIPLKKREIKLSDDFDSPVKGPLCKSVTPTKEFLKDEIKQEEETCKRISTITALGHEGKQLVNGEVSDER
  VAPNFKTEPIETKFYETKEESYSPSKDRNIITEGNGTESLNSVITSMKTGELEKETAPLRKDADSSISVLEIHSQ
  KAQIEEPDPPEMETSLDSSEMAKDLSSKTALSSTESCTMKGEEKSPKTKKDKRPPILECLEKLEKSKKTFLDKDA
  QRLSPIPEEVPKSTLESEKPGSPEAAETSPPSNIIDHCEKLASEKEVVECQSTSTVGGQSVKKVDLETLKEDSEF
  TKVEMDNLDNAQTSGIEEPSETKGSMQKSKFKYKLVPEEETTASENTEITSERQKEGIKLTIRISSRKKKPDSPP
  KVLEPENKQEKTEKEEEKTNVGRTLRRSPRISRPTAKVAEIRDQKADKKRGEGEDEVEEESTALQKTDKKEILKK
  SEKDTNSKVSKVKPKGKVRWTGSRTRGRWKYSSNDESEGSGSEKSSAASEEEEEKESEEAILADDDEPCKKCGLP
  NHPELILLCDSCDSGYHTACLRPPLMIIPDGEWFCPPCQHKLLCEKLEEQLQDLDVALKKKERAERRKERLVYVG
  ISIENIIPPQEPDFSEDQEEKKKDSKKSKANLLERRSTRTRKCISYRFDEFDEAIDEAIEDDIKEADGGGVGRGK
  DISTITGHRGKDISTILDEERKENKRPQRAAAARRKKRRRLNDLDSDSNLDEEESEDEFKISDGSQDEFVVSDEN
  PDESEEDPPSNDDSDTDFCSRRLRRHPSRPMRQSRRLRRKTPKKKYSDDDEEEESEENSRDSESDFSDDFSDDFV
  ETRRRRSRRNQKRQINYKEDSESDGSQKSLRRGKEIRRVHKRRLSSSESEESYLSKNSEDDELAKESKRSVRKRG
  RSTDEYSEADEEEEEEEGKPSRKRLHRIETDEEESCDNAHGDANQPARDSQPRVLPSEQESTKKPYRIESDEEED
  FENVGKVGSPLDYSLVDLPSTNGQSPGKAIENLIGKPTEKSQTPKDNSTASASLASNGTSGGQEAGAPEEEEDEL
  LRVTDLVDYVCNSEQL

• Structural information:
  • Protein Domains: (17..8-)
    (/note="DDT"-)
  • Interpro: IPR028938  IPR028942  IPR019786  IPR011011  IPR001965   IPR019787  IPR013083  
  • Prosite: PS01359 PS50016
  • STRING: ENSP00000311513
• Other Databases: GeneCards:  RSF1  Malacards:  RSF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004402	histone acetyltransferase activity	IBA	molecular function
GO:0042393	histone binding	IBA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0000123	histone acetyltransferase complex	IBA	cellular component
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0031213	RSF complex	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0034080	CENP-A containing nucleosome assembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016573	histone acetylation	IEA	biological process
GO:0050434	positive regulation of viral transcription	IDA	biological process
GO:0043392	negative regulation of DNA binding	IDA	biological process
GO:0016887	ATPase activity	IDA	NOT|molecular function
GO:0016584	nucleosome positioning	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0006338	chromatin remodeling	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0042393	histone binding	IDA	molecular function
GO:0006334	nucleosome assembly	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0006352	DNA-templated transcription, initiation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0031213	RSF complex	IPI	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq