• Gene id: 51768

Gene Summary

• Gene Symbol: TM7SF3   Gene   UCSC   Ensembl
• Gene name: transmembrane 7 superfamily member 3
• Alternate names: transmembrane 7 superfamily member 3, seven span transmembrane protein, seven transmembrane protein TM7SF3,
• Gene location: 12p11.23 (27014426: 26966523)     Exons: 13     NC_000012.12
• OMIM: 605181

Protein Summary

• Protein general information: Q9NS93  
  • Name: Transmembrane 7 superfamily member 3 (Seven span transmembrane protein)
  • Length: 570  
  • Mass: 64166
  • Tissue specificity: Widely expressed. Highly expressed in kidney and pancreas. {ECO
• Sequence:

  MGFLQLLVVAVLASEHRVAGAAEVFGNSSEGLIEFSVGKFRYFELNRPFPEEAILHDISSNVTFLIFQIHSQYQN
  TTVSFSPTLLSNSSETGTASGLVFILRPEQSTCTWYLGTSGIQPVQNMAILLSYSERDPVPGGCNLEFDLDIDPN
  IYLEYNFFETTIKFAPANLGYARGVDPPPCDAGTDQDSRWRLQYDVYQYFLPENDLTEEMLLKHLQRMVSVPQVK
  ASALKVVTLTANDKTSVSFSSLPGQGVIYNVIVWDPFLNTSAAYIPAHTYACSFEAGEGSCASLGRVSSKVFFTL
  FALLGFFICFFGHRFWKTELFFIGFIIMGFFFYILITRLTPIKYDVNLILTAVTGSVGGMFLVAVWWRFGILSIC
  MLCVGLVLGFLISSVTFFTPLGNLKIFHDDGVFWVTFSCIAILIPVVFMGCLRILNILTCGVIGSYSVVLAIDSY
  WSTSLSYITLNVLKRALNKDFHRAFTNVPFQTNDFIILAVWGMLAVSGITLQIRRERGRPFFPPHPYKLWKQERE
  RRVTNILDPSYHIPPLRERLYGRLTQIKGLFQKEQPAGERTPLLL

• Structural information:
  • Interpro: IPR025256  IPR042502  
  • STRING: ENSP00000342322
• Other Databases: GeneCards:  TM7SF3  Malacards:  TM7SF3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IDA	cellular component
GO:0043069	negative regulation of programmed cell death	IMP	biological process
GO:0043069	negative regulation of programmed cell death	IMP	biological process
GO:0034620	cellular response to unfolded protein	IMP	biological process
GO:0032024	positive regulation of insulin secretion	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881