• Gene id: 51765

Gene Summary

• Gene Symbol: STK26   Gene   UCSC   Ensembl
• Aliases: MASK, MST4
• Gene name: serine/threonine kinase 26
• Alternate names: serine/threonine-protein kinase 26, Mst3 and SOK1-related kinase, STE20-like kinase 4, STE20-like kinase MST4, mammalian Ste20-like protein kinase 4, mammalian sterile 20-like 4, serine/threonine protein kinase 26, serine/threonine protein kinase MST4, serine/thr,
• Gene location: Xq26.2 (132023301: 132075942)     Exons: 13     NC_000023.11
• Gene summary(Entrez): The product of this gene is a member of the GCK group III family of kinases, which are a subset of the Ste20-like kinases. The encoded protein contains an amino-terminal kinase domain, and a carboxy-terminal regulatory domain that mediates homodimerizatio
• OMIM: 613889

Protein Summary

• Protein general information: Q9P289  
  • Name: Serine/threonine protein kinase 26 (EC 2.7.11.1) (MST3 and SOK1 related kinase) (Mammalian STE20 like protein kinase 4) (MST 4) (STE20 like kinase MST4) (Serine/threonine protein kinase MASK)
  • Length: 416  
  • Mass: 46529
• Sequence:

  MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLS
  QCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANV
  LLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPM
  RVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHS
  DDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRN
  QAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP

• Structural information:
  • Protein Domains: (24..27-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR035056  
  • Prosite: PS00107 PS50011
  • CDD: cd06640
  • PDB: 3GGF 3W8I 4FZA 4FZD 4FZF 4GEH 5XY9 5YF4
  • PDBsum: 3GGF 3W8I 4FZA 4FZD 4FZF 4GEH 5XY9 5YF4
  • DIP: 34049
  • STRING: ENSP00000377867
• Other Databases: GeneCards:  STK26  Malacards:  STK26

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031098	stress-activated protein kinase signaling cascade	IBA	biological process
GO:0023014	signal transduction by protein phosphorylation	IBA	biological process
GO:0032147	activation of protein kinase activity	IBA	biological process
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0046777	protein autophosphorylation	IMP	biological process
GO:0012506	vesicle membrane	TAS	cellular component
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0009267	cellular response to starvation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005524	ATP binding	IDA	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0042981	regulation of apoptotic process	IDA	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0071944	cell periphery	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0042542	response to hydrogen peroxide	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0030033	microvillus assembly	IDA	biological process
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005798	Golgi-associated vesicle	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:1903205	regulation of hydrogen peroxide-induced cell death	IMP	biological process
GO:0046777	protein autophosphorylation	IMP	biological process
GO:0006468	protein phosphorylation	IMP	biological process
GO:0004672	protein kinase activity	IMP	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881