• Gene id: 51762

Gene Summary

• Gene Symbol: RAB8B   Gene   UCSC   Ensembl
• Gene name: RAB8B, member RAS oncogene family
• Alternate names: ras-related protein Rab-8B, RAB-8b protein,
• Gene location: 15q22.2 (63189535: 63267775)     Exons: 11     NC_000015.10
• Gene summary(Entrez): RAB proteins, like RAB8B, are low molecular mass monomeric GTPases that localize on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB proteins function in intracellular vesicle transport by aiding in the docking and/or fusion of vesicles
• OMIM: 613532

Protein Summary

• Protein general information: Q92930  
  • Name: Ras related protein Rab 8B
  • Length: 207  
  • Mass: 23584
• Sequence:

  MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITT
  AYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLET
  SAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  
  • Prosite: PS51419
  • STRING: ENSP00000312734
• Other Databases: GeneCards:  RAB8B  Malacards:  RAB8B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IBA	molecular function
GO:0005768	endosome	IBA	cellular component
GO:0008021	synaptic vesicle	IBA	cellular component
GO:0012505	endomembrane system	IBA	cellular component
GO:0017157	regulation of exocytosis	IBA	biological process
GO:0030140	trans-Golgi network transport vesicle	IBA	cellular component
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0032869	cellular response to insulin stimulus	IBA	biological process
GO:0072659	protein localization to plasma membrane	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0006904	vesicle docking involved in exocytosis	IBA	biological process
GO:0009306	protein secretion	IBA	biological process
GO:0048210	Golgi vesicle fusion to target membrane	IBA	biological process
GO:0019003	GDP binding	IDA	molecular function
GO:0045335	phagocytic vesicle	IDA	cellular component
GO:0150115	cell-substrate junction organization	ISS	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0055038	recycling endosome membrane	TAS	cellular component
GO:0150115	cell-substrate junction organization	IEA	biological process
GO:0051461	positive regulation of corticotropin secretion	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0030911	TPR domain binding	IEA	molecular function
GO:0098793	presynapse	IEA	cellular component
GO:0051286	cell tip	IEA	cellular component
GO:0031346	positive regulation of cell projection organization	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005778	peroxisomal membrane	IDA	cellular component
GO:0045046	protein import into peroxisome membrane	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0019882	antigen processing and presentation	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0060271	cilium assembly	IMP	NOT|biological process
GO:0003924	GTPase activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04530	Tight junction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray