• Gene id: 51755

Gene Summary

• Gene Symbol: CDK12   Gene   UCSC   Ensembl
• Aliases: CRK7, CRKR, CRKRS
• Gene name: cyclin dependent kinase 12
• Alternate names: cyclin-dependent kinase 12, CDC2-related protein kinase 7, Cdc2-related kinase, arginine/serine-rich, cell division cycle 2-related protein kinase 7, cell division protein kinase 12,
• Gene location: 17q12 (39461485: 39567559)     Exons: 26     NC_000017.11
• OMIM: 607368

Protein Summary

• Protein general information: Q9NYV4  
  • Name: Cyclin dependent kinase 12 (EC 2.7.11.22) (EC 2.7.11.23) (Cdc2 related kinase, arginine/serine rich) (CrkRS) (Cell division cycle 2 related protein kinase 7) (CDC2 related protein kinase 7) (Cell division protein kinase 12) (hCDK12)
  • Length: 1490  
  • Mass: 164155
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MPNSERHGGKKDGSGGASGTLQPSSGGGSSNSRERHRLVSKHKRHKSKHSKDMGLVTPEAASLGTVIKPLVEYDD
  ISSDSDTFSDDMAFKLDRRENDERRGSDRSDRLHKHRHHQHRRSRDLLKAKQTEKEKSQEVSSKSGSMKDRISGS
  SKRSNEETDDYGKAQVAKSSSKESRSSKLHKEKTRKERELKSGHKDRSKSHRKRETPKSYKTVDSPKRRSRSPHR
  KWSDSSKQDDSPSGASYGQDYDLSPSRSHTSSNYDSYKKSPGSTSRRQSVSPPYKEPSAYQSSTRSPSPYSRRQR
  SVSPYSRRRSSSYERSGSYSGRSPSPYGRRRSSSPFLSKRSLSRSPLPSRKSMKSRSRSPAYSRHSSSHSKKKRS
  SSRSRHSSISPVRLPLNSSLGAELSRKKKERAAAAAAAKMDGKESKGSPVFLPRKENSSVEAKDSGLESKKLPRS
  VKLEKSAPDTELVNVTHLNTEVKNSSDTGKVKLDENSEKHLVKDLKAQGTRDSKPIALKEEIVTPKETETSEKET
  PPPLPTIASPPPPLPTTTPPPQTPPLPPLPPIPALPQQPPLPPSQPAFSQVPASSTSTLPPSTHSKTSAVSSQAN
  SQPPVQVSVKTQVSVTAAIPHLKTSTLPPLPLPPLLPGDDDMDSPKETLPSKPVKKEKEQRTRHLLTDLPLPPEL
  PGGDLSPPDSPEPKAITPPQQPYKKRPKICCPRYGERRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTG
  ELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLE
  SGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLW
  YRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPK
  KQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRRQ
  RQSGVVVEEPPPSKTSRKETTSGTSTEPVKNSSPAPPQPAPGKVESGAGDAIGLADITQQLNQSELAVLLNLLQS
  QTDLSIPQMAQLLNIHSNPEMQQQLEALNQSISALTEATSQQQDSETMAPEESLKEAPSAPVILPSAEQTTLEAS
  STPADMQNILAVLLSQLMKTQEPAGSLEENNSDKNSGPQGPRRTPTMPQEEAAACPPHILPPEKRPPEPPGPPPP
  PPPPPLVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSA
  IDTDERNSGPALTESLVQTLVKNRTFSGSLSHLGESSSYQGTGSVQFPGDQDLRFARVPLALHPVVGQPFLKAEG
  SSNSVVHAETKLQNYGELGPGTTGASSSGAGLHWGGPTQSSAYGKLYRGPTRVPPRGGRGRGVPY

• Structural information:
  • Protein Domains: (727..102-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 4CXA 4NST 4UN0 5ACB 6B3E 6CKX
  • PDBsum: 4CXA 4NST 4UN0 5ACB 6B3E 6CKX
  • DIP: 39768
  • STRING: ENSP00000398880
• Other Databases: GeneCards:  CDK12  Malacards:  CDK12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004672	protein kinase activity	IDA	molecular function
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0032968	positive regulation of transcription elongation from RNA polymerase II promoter	IBA	biological process
GO:0008353	RNA polymerase II CTD heptapeptide repeat kinase activity	IBA	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IBA	cellular component
GO:0070816	phosphorylation of RNA polymerase II C-terminal domain	IBA	biological process
GO:0006468	protein phosphorylation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0008353	RNA polymerase II CTD heptapeptide repeat kinase activity	IMP	molecular function
GO:0070816	phosphorylation of RNA polymerase II C-terminal domain	IMP	biological process
GO:0043405	regulation of MAP kinase activity	IMP	biological process
GO:0019908	nuclear cyclin-dependent protein kinase holoenzyme complex	ISS	cellular component
GO:0008380	RNA splicing	ISS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0008353	RNA polymerase II CTD heptapeptide repeat kinase activity	IEA	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IEA	molecular function
GO:0002944	cyclin K-CDK12 complex	IPI	cellular component
GO:0030332	cyclin binding	IPI	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0043484	regulation of RNA splicing	IEA	biological process
GO:0030332	cyclin binding	IEA	molecular function
GO:0019908	nuclear cyclin-dependent protein kinase holoenzyme complex	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:2000737	negative regulation of stem cell differentiation	IEA	biological process
GO:0016607	nuclear speck	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray