• Gene id: 51744

Gene Summary

• Gene Symbol: CD244   Gene   UCSC   Ensembl
• Aliases: 2B4, NAIL, NKR2B4, Nmrk, SLAMF4
• Gene name: CD244 molecule
• Alternate names: natural killer cell receptor 2B4, CD244 molecule, natural killer cell receptor 2B4, NK cell activation inducing ligand NAIL, NK cell activation-inducing ligand, NK cell type I receptor protein 2B4, SLAM family member 4, h2B4, signaling lymphocytic activation mol,
• Gene location: 1q23.3 (160862891: 160830159)     Exons: 9     NC_000001.11
• Gene summary(Entrez): This gene encodes a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediate non-major histocompatibility complex (MHC) restricted killing. The interaction between NK-cell and target cells via this receptor is thought t
• OMIM: 602035

Protein Summary

• Protein general information: Q9BZW8  
  • Name: Natural killer cell receptor 2B4 (NK cell activation inducing ligand) (NAIL) (NK cell type I receptor protein 2B4) (NKR2B4) (h2B4) (SLAM family member 4) (SLAMF4) (Signaling lymphocytic activation molecule 4) (CD antigen CD244)
  • Length: 370  
  • Mass: 41616
  • Tissue specificity: Expressed in spleen, PBL, followed by lung, liver, testis and small intestine. Expressed in all natural killer (NK) cells, monocytes and basophils, TCR-gamma/delta+ T-cells, monocytes, basophils, and on a subset of CD8(+) T-cells. {ECO
• Sequence:

  MLGQVVTLILLLLLKVYQGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLP
  SNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQGQGKILDRGR
  CQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEF
  RFWPFLVIIVILSALFLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQEQTFPGGGSTIYSMI
  QSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNPARLSRKELENFDVYS

• Structural information:
  • Protein Domains: (22..12-)
    (/note="Ig-like-1)
    (131..21-)
    (/note="Ig-like-2")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR024304  IPR024303  
  • Prosite: PS50835
  • DIP: 40331
  • STRING: ENSP00000357012
• Other Databases: GeneCards:  CD244  Malacards:  CD244

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060732	positive regulation of inositol phosphate biosynthetic process	IDA	biological process
GO:2000484	positive regulation of interleukin-8 secretion	IDA	biological process
GO:1902715	positive regulation of interferon-gamma secretion	IDA	biological process
GO:0071663	positive regulation of granzyme B production	IDA	biological process
GO:0042288	MHC class I protein binding	IDA	molecular function
GO:0002323	natural killer cell activation involved in immune response	IDA	biological process
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0060732	positive regulation of inositol phosphate biosynthetic process	IDA	biological process
GO:2000484	positive regulation of interleukin-8 secretion	IDA	biological process
GO:1902715	positive regulation of interferon-gamma secretion	IDA	biological process
GO:0071663	positive regulation of granzyme B production	IDA	biological process
GO:0042288	MHC class I protein binding	IDA	molecular function
GO:0002323	natural killer cell activation involved in immune response	IDA	biological process
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04650	Natural killer cell mediated cytotoxicity

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881