• Gene id: 51734

Gene Summary

• Gene Symbol: MSRB1   Gene   UCSC   Ensembl
• Aliases: HSPC270, SELR, SELX, SEPX1, SepR
• Gene name: methionine sulfoxide reductase B1
• Alternate names: methionine-R-sulfoxide reductase B1, selenoprotein R, selenoprotein X, 1,
• Gene location: 16p13.3 (1943325: 1938228)     Exons: 4     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the methionine-R-sulfoxide reductase B (MsrB) family. Members of this family function as repair enzymes that protect proteins from oxidative stress by catalyzing the reduction of methionine-R-sulfoxides to methi
• OMIM: 126391

Protein Summary

• Protein general information: Q9NZV6  
  • Name: Methionine R sulfoxide reductase B1 (MsrB1) (EC 1.8.4.12) (EC 1.8.4.14) (Selenoprotein X) (SelX)
  • Length: 116  
  • Mass: 12760
• Sequence:

  MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCG
  NGLGHEFLNDGPKPGQSRFUIFSSSLKFVPKGKETSASQGH

• Structural information:
  • Protein Domains: (1..10-)
    (/note="MsrB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01126"-)
  • Interpro: IPR002579  IPR011057  
  • Prosite: PS51790
  • PDB: 3MAO
  • PDBsum: 3MAO
  • STRING: ENSP00000355084
• Other Databases: GeneCards:  MSRB1  Malacards:  MSRB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	ISS	molecular function
GO:0030091	protein repair	ISS	biological process
GO:0045087	innate immune response	ISS	biological process
GO:0030041	actin filament polymerization	ISS	biological process
GO:0015629	actin cytoskeleton	ISS	colocalizes with
GO:0003779	actin binding	ISS	molecular function
GO:0033743	peptide-methionine (R)-S-oxide reductase activity	ISS	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0033743	peptide-methionine (R)-S-oxide reductase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0033745	L-methionine-(R)-S-oxide reductase activity	IEA	molecular function
GO:0033743	peptide-methionine (R)-S-oxide reductase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0030091	protein repair	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0030041	actin filament polymerization	IEA	biological process
GO:0030091	protein repair	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0070191	methionine-R-sulfoxide reductase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0033743	peptide-methionine (R)-S-oxide reductase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005575	cellular_component	ND	cellular component
GO:0008270	zinc ion binding	ISS	molecular function
GO:0030091	protein repair	ISS	biological process
GO:0045087	innate immune response	ISS	biological process
GO:0030041	actin filament polymerization	ISS	biological process
GO:0015629	actin cytoskeleton	ISS	colocalizes with
GO:0003779	actin binding	ISS	molecular function
GO:0033743	peptide-methionine (R)-S-oxide reductase activity	ISS	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0033743	peptide-methionine (R)-S-oxide reductase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0033745	L-methionine-(R)-S-oxide reductase activity	IEA	molecular function
GO:0033743	peptide-methionine (R)-S-oxide reductase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0030091	protein repair	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0030041	actin filament polymerization	IEA	biological process
GO:0030091	protein repair	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0070191	methionine-R-sulfoxide reductase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0033743	peptide-methionine (R)-S-oxide reductase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray