• Gene id: 51728

Gene Summary

• Gene Symbol: POLR3K   Gene   UCSC   Ensembl
• Aliases: C11, C11-RNP3, My010, RPC10, RPC11, RPC12.5
• Gene name: RNA polymerase III subunit K
• Alternate names: DNA-directed RNA polymerase III subunit RPC10, DNA-directed RNA polymerase III subunit K, DNA-directed RNA polymerases III 12.5 kDa polypeptide, RNA polymerase III 12.5 kDa subunit, RNA polymerase III subunit C10, RNA polymerase III subunit C11, RNA polymerase ,
• Gene location: 16p13.3 (53607: 46406)     Exons: 3     NC_000016.10
• Gene summary(Entrez): This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the
• OMIM: 606007

Protein Summary

• Protein general information: Q9Y2Y1  
  • Name: DNA directed RNA polymerase III subunit RPC10 (RNA polymerase III subunit C10) (DNA directed RNA polymerase III subunit K) (RNA polymerase III 12.5 kDa subunit) (RPC12.5) (RNA polymerase III subunit C11) (HsC11p) (RPC11) (hRPC11)
  • Length: 108  
  • Mass: 12336
• Sequence:

  MLLFCPGCGNGLIVEEGQRCHRFSCNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHP
  RAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD

• Structural information:
  • Interpro: IPR019761  IPR001529  IPR012164  IPR034014  IPR001222  
  • Prosite: PS01030 PS00466 PS51133
  • CDD: cd10509
  • STRING: ENSP00000293860
• Other Databases: GeneCards:  POLR3K  Malacards:  POLR3K

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005666	RNA polymerase III complex	IBA	cellular component
GO:0006386	termination of RNA polymerase III transcription	IBA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0042779	tRNA 3'-trailer cleavage	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003899	DNA-directed 5'-3' RNA polymerase activity	IEA	molecular function
GO:0003899	DNA-directed 5'-3' RNA polymerase activity	TAS	molecular function
GO:0005666	RNA polymerase III complex	TAS	cellular component
GO:0006383	transcription by RNA polymerase III	TAS	biological process
GO:0032481	positive regulation of type I interferon production	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04623	Cytosolic DNA-sensing pathway
hsa03020	RNA polymerase

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881