• Gene id: 51726

Gene Summary

• Gene Symbol: DNAJB11   Gene   UCSC   Ensembl
• Aliases: ABBP-2, ABBP2, DJ9, Dj-9, EDJ, ERdj3, ERj3, ERj3p, PKD6, PRO1080, UNQ537
• Gene name: DnaJ heat shock protein family (Hsp40) member B11
• Alternate names: dnaJ homolog subfamily B member 11, APOBEC1-binding protein 2, DnaJ (Hsp40) homolog, subfamily B, member 11, DnaJ protein 9, ER-associated DNAJ protein 3, ER-associated Hsp40 co-chaperone, ER-resident protein ERdj3, PWP1-interacting protein 4, endoplasmic reticul,
• Gene location: 3q27.3 (124712731: 124664047)     Exons: 5     NC_000004.12
• Gene summary(Entrez): This gene encodes a soluble glycoprotein of the endoplasmic reticulum (ER) lumen that functions as a co-chaperone of binding immunoglobulin protein, a 70 kilodalton heat shock protein chaperone required for the proper folding and assembly of proteins in t
• OMIM: 611341

Protein Summary

• Protein general information: Q9UBS4  
  • Name: DnaJ homolog subfamily B member 11 (APOBEC1 binding protein 2) (ABBP 2) (DnaJ protein homolog 9) (ER associated DNAJ) (ER associated Hsp40 co chaperone) (Endoplasmic reticulum DNA J domain containing protein 3) (ER resident protein ERdj3) (ERdj3) (ERj3p)
  • Length: 358  
  • Mass: 40514
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MAPQNLSTFCLLLLYLIGAVIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYE
  VLSDSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNF
  VEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFI
  GEGEPHVDGEPGDLRFRIKVVKHPIFERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLW
  KKGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYNGLQGY

• Structural information:
  • Protein Domains: (25..9-)
    (/note="J-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00286"-)
  • Interpro: IPR002939  IPR001623  IPR018253  IPR008971  IPR036869  
  • Prosite: PS00636 PS50076
  • CDD: cd06257
  • DIP: 29678
  • STRING: ENSP00000414398
• Other Databases: GeneCards:  DNAJB11  Malacards:  DNAJB11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051604	protein maturation	IMP	biological process
GO:0006457	protein folding	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0032781	positive regulation of ATPase activity	IDA	biological process
GO:0036498	IRE1-mediated unfolded protein response	TAS	biological process
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Polycystic kidney disease	KEGG:H00542
Polycystic kidney disease	KEGG:H00542
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881