• Gene id: 51719

Gene Summary

• Gene Symbol: CAB39   Gene   UCSC   Ensembl
• Aliases: CGI-66, MO25
• Gene name: calcium binding protein 39
• Alternate names: calcium-binding protein 39, MO25alpha,
• Gene location: 2q37.1 (230712841: 230821074)     Exons: 11     NC_000002.12
• OMIM: 612174

Protein Summary

• Protein general information: Q9Y376  
  • Name: Calcium binding protein 39 (MO25alpha) (Protein Mo25)
  • Length: 341  
  • Mass: 39869
• Sequence:

  MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQELY
  NSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLREC
  IRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVT
  KRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQA
  KLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAQQEA

• Structural information:
  • Interpro: IPR011989  IPR016024  IPR013878  
  • PDB: 1UPK 1UPL 2WTK 3GNI 4FZA 4FZD 4FZF 4NZW 4O27
  • PDBsum: 1UPK 1UPL 2WTK 3GNI 4FZA 4FZD 4FZF 4NZW 4O27
  • DIP: 31316
  • STRING: ENSP00000258418
• Other Databases: GeneCards:  CAB39  Malacards:  CAB39

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043539	protein serine/threonine kinase activator activity	IDA	molecular function
GO:0043539	protein serine/threonine kinase activator activity	IDA	molecular function
GO:0043539	protein serine/threonine kinase activator activity	IDA	molecular function
GO:1901017	negative regulation of potassium ion transmembrane transporter activity	IC	biological process
GO:1901380	negative regulation of potassium ion transmembrane transport	IC	biological process
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0071476	cellular hypotonic response	IC	biological process
GO:0023014	signal transduction by protein phosphorylation	IDA	biological process
GO:1902554	serine/threonine protein kinase complex	IC	cellular component
GO:0071902	positive regulation of protein serine/threonine kinase activity	IDA	biological process
GO:0071902	positive regulation of protein serine/threonine kinase activity	IDA	biological process
GO:0010800	positive regulation of peptidyl-threonine phosphorylation	IDA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0043539	protein serine/threonine kinase activator activity	IBA	molecular function
GO:0030295	protein kinase activator activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007050	cell cycle arrest	TAS	biological process
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097066	response to thyroid hormone	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0014823	response to activity	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0030018	Z disc	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0019900	kinase binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04150	mTOR signaling pathway
hsa04152	AMPK signaling pathway

Diseases

Associated diseases	References
pancreatic cancer	PMID:28197410
hepatocellular carcinoma	PMID:28605041
hepatocellular carcinoma	PMID:28605041
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)