• Gene id: 51714

Gene Summary

• Gene Symbol: SELENOT   Gene   UCSC   Ensembl
• Aliases: SELT
• Gene name: selenoprotein T
• Alternate names: thioredoxin reductase-like selenoprotein T, thioredoxin reductase-like enzyme,
• Gene location: 3q25.1 (150603320: 150630435)     Exons: 6     NC_000003.12
• Gene summary(Entrez): This gene encodes a selenoprotein, containing a selenocysteine (Sec) residue at the active site. Sec is encoded by the UGA codon that normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the
• OMIM: 607912

Protein Summary

• Protein general information: P62341  
  • Name: Thioredoxin reductase like selenoprotein T (SelT) (EC 1.8.1.9)
  • Length: 195  
  • Mass: 22324
  • Tissue specificity: Ubiquitous. Highly expressed in the endocrine pancreas. {ECO
• Sequence:

  MRLLLLLLVAASAMVRSEASANLGGVPSKRLKMQYATGPLLKFQICVSUGYRRVFEEYMRVISQRYPDIRIEGEN
  YLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFE
  ITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS

• Structural information:
  • Interpro: IPR011893  IPR019389  IPR036249  
  • STRING: ENSP00000418910
• Other Databases: GeneCards:  SELENOT  Malacards:  SELENOT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045454	cell redox homeostasis	IDA	biological process
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0042593	glucose homeostasis	ISS	biological process
GO:0035773	insulin secretion involved in cellular response to glucose stimulus	ISS	biological process
GO:0009749	response to glucose	ISS	biological process
GO:0005789	endoplasmic reticulum membrane	ISS	cellular component
GO:0060124	positive regulation of growth hormone secretion	ISS	biological process
GO:0004791	thioredoxin-disulfide reductase activity	ISS	molecular function
GO:0031016	pancreas development	ISS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	ISS	biological process
GO:0098869	cellular oxidant detoxification	ISS	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004791	thioredoxin-disulfide reductase activity	IEA	molecular function
GO:0045454	cell redox homeostasis	IEA	biological process
GO:0031016	pancreas development	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0035773	insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0009749	response to glucose	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0008430	selenium binding	NAS	molecular function
GO:0001514	selenocysteine incorporation	NAS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray