• Gene id: 51704

Gene Summary

• Gene Symbol: GPRC5B   Gene   UCSC   Ensembl
• Aliases: RAIG-2, RAIG2
• Gene name: G protein-coupled receptor class C group 5 member B
• Alternate names: G-protein coupled receptor family C group 5 member B, G protein-coupled receptor, family C, group 1, member B, retinoic acid responsive gene protein, retinoic acid-induced gene 2 protein,
• Gene location: 16p12.3 (19886044: 19856690)     Exons: 7     NC_000016.10
• Gene summary(Entrez): This gene encodes a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The encoded protein may modulate insulin secretion and increased protein expression is a

Protein Summary

• Protein general information: Q9NZH0  
  • Name: G protein coupled receptor family C group 5 member B (A 69G12.1) (Retinoic acid induced gene 2 protein) (RAIG 2)
  • Length: 403  
  • Mass: 44795
  • Tissue specificity: Expression is high in kidney, pancreas, and testis, medium in brain, heart, prostate, small intestine, and spleen, low in liver, placenta, skeletal muscle, colon, ovary, and thymus, and not detectable in lung and peripheral leukocyte.
• Sequence:

  MFVASERKMRAHQVLTFLLLFVITSVASENASTSRGCGLDLLPQYVSLCDLDAIWGIVVEAVAGAGALITLLLML
  ILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLTFAFIIQEDETICSVRRFLWGVLFALCFSCLLSQAWRVRRL
  VRHGTGPAGWQLVGLALCLMLVQVIIAVEWLVLTVLRDTRPACAYEPMDFVMALIYDMVLLVVTLGLALFTLCGK
  FKRWKLNGAFLLITAFLSVLIWVAWMTMYLFGNVKLQQGDAWNDPTLAITLAASGWVFVIFHAIPEIHCTLLPAL
  QENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPSGSLGKRPSAPFRSNV
  YQPTEMAVVLNGGTIPTAPPSHTGRHLW

• Structural information:
  • Interpro: IPR017978  
  • Prosite: PS50259
  • STRING: ENSP00000300571
• Other Databases: GeneCards:  GPRC5B  Malacards:  GPRC5B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030295	protein kinase activator activity	IDA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0090263	positive regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0060907	positive regulation of macrophage cytokine production	ISS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0061098	positive regulation of protein tyrosine kinase activity	ISS	biological process
GO:0019901	protein kinase binding	ISS	molecular function
GO:0009986	cell surface	ISS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0050729	positive regulation of inflammatory response	ISS	biological process
GO:0045666	positive regulation of neuron differentiation	ISS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	ISS	biological process
GO:0005615	extracellular space	HDA	cellular component
GO:0001664	G protein-coupled receptor binding	ISS	molecular function
GO:0070062	extracellular exosome	IBA	cellular component
GO:0043235	receptor complex	IBA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0030295	protein kinase activator activity	IBA	molecular function
GO:0019901	protein kinase binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030295	protein kinase activator activity	IDA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0090263	positive regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0060907	positive regulation of macrophage cytokine production	ISS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0061098	positive regulation of protein tyrosine kinase activity	ISS	biological process
GO:0019901	protein kinase binding	ISS	molecular function
GO:0009986	cell surface	ISS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0050729	positive regulation of inflammatory response	ISS	biological process
GO:0045666	positive regulation of neuron differentiation	ISS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	ISS	biological process
GO:0005615	extracellular space	HDA	cellular component
GO:0001664	G protein-coupled receptor binding	ISS	molecular function
GO:0070062	extracellular exosome	IBA	cellular component
GO:0043235	receptor complex	IBA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0030295	protein kinase activator activity	IBA	molecular function
GO:0019901	protein kinase binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq