• Gene id: 51703

Gene Summary

• Gene Symbol: ACSL5   Gene   UCSC   Ensembl
• Aliases: ACS2, ACS5, FACL5
• Gene name: acyl-CoA synthetase long chain family member 5
• Alternate names: long-chain-fatty-acid--CoA ligase 5, FACL5 for fatty acid coenzyme A ligase 5, LACS 5, arachidonate--CoA ligase, fatty acid coenzyme A ligase 5, fatty-acid-Coenzyme A ligase, long-chain 5, long-chain acyl-CoA synthetase 5, long-chain fatty acid coenzyme A ligase,
• Gene location: 10q25.2 (112374115: 112428379)     Exons: 23     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty
• OMIM: 605677

Protein Summary

• Protein general information: Q9ULC5  
  • Name: Long chain fatty acid CoA ligase 5 (EC 6.2.1.3) (Arachidonate CoA ligase) (EC 6.2.1.15) (Long chain acyl CoA synthetase 5) (LACS 5)
  • Length: 683  
  • Mass: 75991
• Sequence:

  MLFIFNFLFSPLPTPALICILTFGAAIFLWLITRPQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAK
  TMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSSPDQFVGIFAQNRPEWIISEL
  ACYTYSMVAVPLYDTLGPEAIVHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEK
  SGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPKGAMITHQNIVSNAAAFLKCVEHAYEPTPDDV
  AISYLPLAHMFERIVQAVVYSCGARVGFFQGDIRLLADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLL
  KLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGAAPMSTSVMTFFRAAMGCQVYEAYGQTECTG
  GCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGD
  IGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKL
  GVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLKAKRGELSKYFRTQID
  SLYEHIQD

• Structural information:
  • Interpro: IPR020845  IPR000873  IPR042099  
  • Prosite: PS00455
  • STRING: ENSP00000348429
• Other Databases: GeneCards:  ACSL5  Malacards:  ACSL5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001676	long-chain fatty acid metabolic process	IBA	biological process
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0008610	lipid biosynthetic process	IBA	biological process
GO:0035338	long-chain fatty-acyl-CoA biosynthetic process	IBA	biological process
GO:0047676	arachidonate-CoA ligase activity	IBA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IBA	molecular function
GO:0005739	mitochondrion	IBA	cellular component
GO:0010747	positive regulation of long-chain fatty acid import across plasma membrane	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0001676	long-chain fatty acid metabolic process	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0004467	long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0001676	long-chain fatty acid metabolic process	IMP	biological process
GO:0047676	arachidonate-CoA ligase activity	ISS	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IMP	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016874	ligase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003996	acyl-CoA ligase activity	IEA	molecular function
GO:0102391	decanoate-CoA ligase activity	IEA	molecular function
GO:0047676	arachidonate-CoA ligase activity	IEA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0035338	long-chain fatty-acyl-CoA biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001676	long-chain fatty acid metabolic process	IEA	biological process
GO:0004467	long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04714	Thermogenesis
hsa04146	Peroxisome
hsa03320	PPAR signaling pathway
hsa01212	Fatty acid metabolism
hsa04920	Adipocytokine signaling pathway
hsa00071	Fatty acid degradation
hsa04216	Ferroptosis
hsa00061	Fatty acid biosynthesis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)