• Gene id: 51701

Gene Summary

• Gene Symbol: NLK   Gene   UCSC   Ensembl
• Gene name: nemo like kinase
• Alternate names: serine/threonine-protein kinase NLK,
• Gene location: 17q11.2 (206084252: 206086859)     Exons: 3     NC_000002.12
• OMIM: 609476

Protein Summary

• Protein general information: Q9UBE8  
  • Name: Serine/threonine protein kinase NLK (EC 2.7.11.24) (Nemo like kinase) (Protein LAK1)
  • Length: 527  
  • Mass: 58283
• Sequence:

  MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAAVHPVQQHTSSAAAAA
  AAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAATVKAHHHQHSHHPQQQLDIEPDRPIGYGAFG
  VVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSD
  LHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
  VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAH
  ILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTGRV
  YTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLV
  WE

• Structural information:
  • Protein Domains: (138..42-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR003527  IPR000719  IPR017441  IPR008271  
  • Prosite: PS01351 PS00107 PS50011 PS00108
  • STRING: ENSP00000384625
• Other Databases: GeneCards:  NLK  Malacards:  NLK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004707	MAP kinase activity	IBA	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0010468	regulation of gene expression	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0050821	protein stabilization	IDA	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0004672	protein kinase activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0007223	Wnt signaling pathway, calcium modulating pathway	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042169	SH2 domain binding	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IEA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0042501	serine phosphorylation of STAT protein	IEA	biological process
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000165	MAPK cascade	IEA	biological process
GO:0000165	MAPK cascade	IEA	biological process
GO:0000165	MAPK cascade	IEA	biological process
GO:0000165	MAPK cascade	IEA	biological process
GO:0000165	MAPK cascade	IEA	biological process
GO:0042169	SH2 domain binding	ISS	molecular function
GO:0030178	negative regulation of Wnt signaling pathway	ISS	biological process
GO:0018107	peptidyl-threonine phosphorylation	ISS	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0007179	transforming growth factor beta receptor signaling pathway	IMP	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0004707	MAP kinase activity	ISS	molecular function
GO:0000287	magnesium ion binding	ISS	molecular function
GO:0035556	intracellular signal transduction	ISS	biological process
GO:0006468	protein phosphorylation	ISS	biological process
GO:0006355	regulation of transcription, DNA-templated	ISS	biological process
GO:0005524	ATP binding	ISS	molecular function
GO:0042501	serine phosphorylation of STAT protein	ISS	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04310	Wnt signaling pathway
hsa04068	FoxO signaling pathway
hsa04520	Adherens junction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray