• Gene id: 51699

Gene Summary

• Gene Symbol: VPS29   Gene   UCSC   Ensembl
• Aliases: DC15, DC7, PEP11
• Gene name: VPS29 retromer complex component
• Alternate names: vacuolar protein sorting-associated protein 29, PEP11 homolog, epididymis secretory sperm binding protein, hVPS29, retromer protein, vacuolar protein sorting 29 homolog, vacuolar sorting protein VPS29/PEP11, vesicle protein sorting 29, x 007 protein,
• Gene location: 12q24.11 (63216130: 63195428)     Exons: 6     NC_000020.11
• Gene summary(Entrez): This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex, termed the retrome
• OMIM: 606932

Protein Summary

• Protein general information: Q9UBQ0  
  • Name: Vacuolar protein sorting associated protein 29 (hVPS29) (PEP11 homolog) (Vesicle protein sorting 29)
  • Length: 182  
  • Mass: 20506
  • Tissue specificity: Ubiquitous. Highly expressed in heart, lung, placenta, spleen, peripheral blood leukocytes, thymus, colon skeletal muscle, kidney and brain.
• Sequence:

  MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVV
  TVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSF
  VLMDIQASTVVTYVYQLIGDDVKVERIEYKKP

• Structural information:
  • Interpro: IPR024654  IPR029052  IPR000979  IPR028661  
  • CDD: cd07394
  • PDB: 1W24 2R17 5GTU 5OSH 5OSI 5WYH
  • PDBsum: 1W24 2R17 5GTU 5OSH 5OSI 5WYH
  • DIP: 29077
  • STRING: ENSP00000480853
• Other Databases: GeneCards:  VPS29  Malacards:  VPS29

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030906	retromer, cargo-selective complex	IDA	cellular component
GO:0010506	regulation of autophagy	IMP	NOT|biological process
GO:0030906	retromer, cargo-selective complex	NAS	cellular component
GO:0042147	retrograde transport, endosome to Golgi	NAS	biological process
GO:0005768	endosome	IBA	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IBA	biological process
GO:0030904	retromer complex	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0030904	retromer complex	IDA	cellular component
GO:0030904	retromer complex	IDA	cellular component
GO:1990126	retrograde transport, endosome to plasma membrane	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990126	retrograde transport, endosome to plasma membrane	IMP	biological process
GO:0032456	endocytic recycling	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030904	retromer complex	IEA	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0005768	endosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)