• Gene id: 51696

Gene Summary

• Gene Symbol: HECA   Gene   UCSC   Ensembl
• Aliases: HDC, HDCL, HHDC, dJ225E12.1
• Gene name: hdc homolog, cell cycle regulator
• Alternate names: headcase protein homolog, headcase homolog,
• Gene location: 6q24.1 (95069496: 95036771)     Exons: 10     NC_000010.11
• Gene summary(Entrez): This gene encodes the homolog of the Drosophila headcase protein, a highly basic, cytoplasmic protein that regulates the re-entry of imaginal cells into the mitotic cycle during adult morphogenesis. In Drosophila, the encoded protein also inhibits termina
• OMIM: 607977

Protein Summary

• Protein general information: Q9UBI9  
  • Name: Headcase protein homolog (hHDC)
  • Length: 543  
  • Mass: 58837
  • Tissue specificity: Expressed in all tissues examined. Highest levels are in the spleen, thymus, peripheral blood and heart. Lowest in the kidney and pancreas. {ECO
• Sequence:

  MPNPKNSKGGRKNKRANSSGDEQENGAGALAAAGAAGAAAGGALAAAAGCGAAAAGAPGAGGAAGAGGAGTGAAN
  AAAAAGAAAAGDAKNEAPCATPLICSFGRPVDLEKDDYQKVVCNNEHCPCSTWMHLQCFYEWESSILVQFNCIGR
  ARSWNEKQCRQNMWTKKGYDLAFRFCSCRCGQGHLKKDTDWYQVKRMQDEKKKKSGSEKNTGRPPGEAAEEAKKC
  RPPNKPQKGPSHDLPRRHSMDRQNSQEKAVGAAAYGARSPGGSPGQSPPTGYSILSPAHFSGPRSSRYLGEFLKN
  AIHLEPHKKAMAGGHVFRNAHFDYSPAGLAVHRGGHFDTPVQFLRRLDLSELLTHIPRHKLNTFHVRMEDDAQVG
  QGEDLRKFILAALSASHRNVVNCALCHRALPVFEQFPLVDGTLFLSPSRHDEIEYDVPCHLQGRLMHLYAVCVDC
  LEGVHKIICIKCKSRWDGSWHQLGTMYTYDILAASPCCQARLNCKHCGKPVIDVRIGMQYFSEYSNVQQCPHCGN
  LDYHFVKPFSSFKVLEAY

• Structural information:
  • Interpro: IPR026066  IPR031947  
  • STRING: ENSP00000356630
• Other Databases: GeneCards:  HECA  Malacards:  HECA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007275	multicellular organism development	IEA	biological process
GO:0045930	negative regulation of mitotic cell cycle	IMP	biological process
GO:0045930	negative regulation of mitotic cell cycle	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0030323	respiratory tube development	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq