• Gene id: 51692

Gene Summary

• Gene Symbol: CPSF3   Gene   UCSC   Ensembl
• Aliases: CPSF-73, CPSF73
• Gene name: cleavage and polyadenylation specific factor 3
• Alternate names: cleavage and polyadenylation specificity factor subunit 3, cleavage and polyadenylation specific factor 3, 73kDa, mRNA 3'-end-processing endonuclease CPSF-73,
• Gene location: 2p25.1 (88337735: 88293591)     Exons: 9     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the metallo-beta-lactamase family. The encoded protein is a 73kDa subunit of the cleavage and polyadenylation specificity factor and functions as an endonuclease that recognizes the pre-mRNA 3'-cleavage site AAUAAA prior to p
• OMIM: 606029

Protein Summary

• Protein general information: Q9UKF6  
  • Name: Cleavage and polyadenylation specificity factor subunit 3 (EC 3.1.27. ) (Cleavage and polyadenylation specificity factor 73 kDa subunit) (CPSF 73 kDa subunit) (mRNA 3' end processing endonuclease CPSF 73)
  • Length: 684  
  • Mass: 77486
• Sequence:

  MSAIPAEESDQLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLISHFHLD
  HCGALPWFLQKTSFKGRTFMTHATKAIYRWLLSDYVKVSNISADDMLYTETDLEESMDKIETINFHEVKEVAGIK
  FWCYHAGHVLGAAMFMIEIAGVKLLYTGDFSRQEDRHLMAAEIPNIKPDILIIESTYGTHIHEKREEREARFCNT
  VHDIVNRGGRGLIPVFALGRAQELLLILDEYWQNHPELHDIPIYYASSLAKKCMAVYQTYVNAMNDKIRKQININ
  NPFVFKHISNLKSMDHFDDIGPSVVMASPGMMQSGLSRELFESWCTDKRNGVIIAGYCVEGTLAKHIMSEPEEIT
  TMSGQKLPLKMSVDYISFSAHTDYQQTSEFIRALKPPHVILVHGEQNEMARLKAALIREYEDNDEVHIEVHNPRN
  TEAVTLNFRGEKLAKVMGFLADKKPEQGQRVSGILVKRNFNYHILSPCDLSNYTDLAMSTVKQTQAIPYTGPFNL
  LCYQLQKLTGDVEELEIQEKPALKVFKNITVIQEPGMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQK
  VSKKLEMHVYSKRLEIMLQDIFGEDCVSVKDDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQR
  LYEALTPVH

• Structural information:
  • Interpro: IPR022712  IPR021718  IPR001279  IPR036866  IPR011108  
  • PDB: 2I7T 2I7V 6M8Q
  • PDBsum: 2I7T 2I7V 6M8Q
  • DIP: 42501
  • STRING: ENSP00000238112
• Other Databases: GeneCards:  CPSF3  Malacards:  CPSF3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003723	RNA binding	IBA	molecular function
GO:0005847	mRNA cleavage and polyadenylation specificity factor complex	IBA	cellular component
GO:0006378	mRNA polyadenylation	IBA	biological process
GO:0008409	5'-3' exonuclease activity	IBA	molecular function
GO:0004521	endoribonuclease activity	IBA	molecular function
GO:0006398	mRNA 3'-end processing by stem-loop binding and cleavage	IBA	biological process
GO:0005847	mRNA cleavage and polyadenylation specificity factor complex	IDA	cellular component
GO:0005847	mRNA cleavage and polyadenylation specificity factor complex	IDA	cellular component
GO:0004521	endoribonuclease activity	ISS	molecular function
GO:0008409	5'-3' exonuclease activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	ISS	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0006378	mRNA polyadenylation	TAS	biological process
GO:0006379	mRNA cleavage	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006369	termination of RNA polymerase II transcription	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0006398	mRNA 3'-end processing by stem-loop binding and cleavage	IEA	biological process
GO:0004521	endoribonuclease activity	IEA	molecular function
GO:0008409	5'-3' exonuclease activity	IEA	molecular function
GO:0005847	mRNA cleavage and polyadenylation specificity factor complex	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0006398	mRNA 3'-end processing by stem-loop binding and cleavage	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa03015	mRNA surveillance pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R