• Gene id: 51691

Gene Summary

• Gene Symbol: LSM8   Gene   UCSC   Ensembl
• Aliases: NAA38
• Gene name: LSM8 homolog, U6 small nuclear RNA associated
• Alternate names: LSM8 homolog, U6 small nuclear RNA associated, LSM8 U6 small nuclear RNA associated, MAK31-like protein, N-alpha-acetyltransferase 38, NatC auxiliary subunit, U6 snRNA-associated Sm-like protein LSm8,
• Gene location: 7q31.31 (118184163: 118204034)     Exons: 4     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the like-Sm family of proteins. The encoded protein consists of a closed barrel shape, made up of five anti-parallel beta strands and an alpha helix. This protein partners with six paralogs to form a heteroheptameric ring whi
• OMIM: 606956

Protein Summary

• Protein general information: O95777  
  • Name: U6 snRNA associated Sm like protein LSm8
  • Length: 96  
  • Mass: 10403
• Sequence:

  MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDE
  ETDSALDLGNIRAEPLNSVAH

• Structural information:
  • Interpro: IPR034103  IPR001163  IPR010920  
  • CDD: cd01727
  • PDB: 3JCR 5O9Z 6AH0 6AHD 6QW6 6QX9
  • PDBsum: 3JCR 5O9Z 6AH0 6AHD 6QW6 6QX9
  • DIP: 31195
  • STRING: ENSP00000249299
• Other Databases: GeneCards:  LSM8  Malacards:  LSM8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003723	RNA binding	IBA	molecular function
GO:0046540	U4/U6 x U5 tri-snRNP complex	IBA	cellular component
GO:0071011	precatalytic spliceosome	IBA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IBA	biological process
GO:0005688	U6 snRNP	IBA	cellular component
GO:0016070	RNA metabolic process	IBA	biological process
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0120115	Lsm2-8 complex	IDA	cellular component
GO:0071005	U2-type precatalytic spliceosome	IDA	cellular component
GO:0046540	U4/U6 x U5 tri-snRNP complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IEA	biological process
GO:0005688	U6 snRNP	IEA	cellular component
GO:0046540	U4/U6 x U5 tri-snRNP complex	IEA	cellular component
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0017070	U6 snRNA binding	NAS	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0046540	U4/U6 x U5 tri-snRNP complex	IBA	cellular component
GO:0071011	precatalytic spliceosome	IBA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IBA	biological process
GO:0005688	U6 snRNP	IBA	cellular component
GO:0016070	RNA metabolic process	IBA	biological process
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0120115	Lsm2-8 complex	IDA	cellular component
GO:0071005	U2-type precatalytic spliceosome	IDA	cellular component
GO:0046540	U4/U6 x U5 tri-snRNP complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IEA	biological process
GO:0005688	U6 snRNP	IEA	cellular component
GO:0046540	U4/U6 x U5 tri-snRNP complex	IEA	cellular component
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0017070	U6 snRNA binding	NAS	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome
hsa03018	RNA degradation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881