• Gene id: 51690

Gene Summary

• Gene Symbol: LSM7   Gene   UCSC   Ensembl
• Aliases: YNL147W
• Gene name: LSM7 homolog, U6 small nuclear RNA and mRNA degradation associated
• Alternate names: U6 snRNA-associated Sm-like protein LSm7, LSM7 U6 small nuclear RNA and mRNA degradation associated, LSM7 homolog, U6 small nuclear RNA associated,
• Gene location: 19p13.3 (2328629: 2321520)     Exons: 5     NC_000019.10
• Gene summary(Entrez): Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length

Protein Summary

• Protein general information: Q9UK45  
  • Name: U6 snRNA associated Sm like protein LSm7
  • Length: 103  
  • Mass: 11602
• Sequence:

  MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVV
  CRGTSVVLICPQDGMEAIPNPFIQQQDA

• Structural information:
  • Interpro: IPR017132  IPR001163  IPR010920  
  • CDD: cd01729
  • PDB: 3JCR 5O9Z 6AH0 6AHD 6QW6 6QX9
  • PDBsum: 3JCR 5O9Z 6AH0 6AHD 6QW6 6QX9
  • DIP: 31129
  • STRING: ENSP00000252622
• Other Databases: GeneCards:  LSM7  Malacards:  LSM7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005688	U6 snRNP	IBA	cellular component
GO:0005689	U12-type spliceosomal complex	IBA	cellular component
GO:0071013	catalytic step 2 spliceosome	IBA	cellular component
GO:0097526	spliceosomal tri-snRNP complex	IBA	cellular component
GO:1990726	Lsm1-7-Pat1 complex	IBA	cellular component
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0071004	U2-type prespliceosome	IBA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0120115	Lsm2-8 complex	IDA	cellular component
GO:0071005	U2-type precatalytic spliceosome	IDA	cellular component
GO:0046540	U4/U6 x U5 tri-snRNP complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IEA	biological process
GO:0000956	nuclear-transcribed mRNA catabolic process	IEA	biological process
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0043928	exonucleolytic catabolism of deadenylated mRNA	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0017070	U6 snRNA binding	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome
hsa03018	RNA degradation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq