• Gene id: 51686

Gene Summary

• Gene Symbol: OAZ3   Gene   UCSC   Ensembl
• Aliases: AZ3, OAZ-t, TISP15
• Gene name: ornithine decarboxylase antizyme 3
• Alternate names: ornithine decarboxylase antizyme 3, ODC-Az 3, antizyme 3, testicular secretory protein Li 31,
• Gene location: 1q21.3 (151762968: 151771329)     Exons: 7     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the ornithine decarboxylase antizyme family, which plays a role in cell growth and proliferation by regulating intracellular polyamine levels. Expression of antizymes requires +1 ribosomal frameshifting, which i
• OMIM: 605138

Protein Summary

• Protein general information: Q9UMX2  
  • Name: Ornithine decarboxylase antizyme 3 (AZ3) (ODC Az 3)
  • Length: 235  
  • Mass: 27,413
• Sequence:

  MPCKRCRPSVYSLSYIKRGKTRNYLYPIWSPYAYYLYCYKYRITLREKMLPRCYKSITYKEEEDLTLQPRSCLQC
  SESLVGLQEGKSTEQGNHDQLKELYSAGNLTVLATDPLLHQDPVQLDFHFRLTSQTSAHWHGLLCDRRLFLDIPY
  QALDQGNRESLTATLEYVEEKTNVDSVFVNFQNDRNDRGALLRAFSYMGFEVVRPDHPALPPLDNVIFMVYPLER
  DVGHLPSEPP

• Structural information:
  • Interpro: IPR016181  IPR029913  IPR002993  IPR038581  
  • Prosite: PS01337
  • STRING: ENSP00000415904
• Other Databases: GeneCards:  OAZ3  Malacards:  OAZ3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006521	regulation of cellular amino acid metabolic process	TAS	biological process
GO:0006596	polyamine biosynthetic process	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008073	ornithine decarboxylase inhibitor activity	ISS	molecular function
GO:0008073	ornithine decarboxylase inhibitor activity	IDA	molecular function
GO:0015489	putrescine transmembrane transporter activity	ISS	molecular function
GO:0015847	putrescine transport	IEA	biological process
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0045732	positive regulation of protein catabolic process	ISS	biological process
GO:0072562	blood microparticle	IDA	cellular component
GO:1902268	negative regulation of polyamine transmembrane transport	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006521	regulation of cellular amino acid metabolic process	TAS	biological process
GO:0006596	polyamine biosynthetic process	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007283	spermatogenesis	TAS	biological process
GO:0008073	ornithine decarboxylase inhibitor activity	IEA	molecular function
GO:0008073	ornithine decarboxylase inhibitor activity	ISS	molecular function
GO:0008073	ornithine decarboxylase inhibitor activity	TAS	molecular function
GO:0008073	ornithine decarboxylase inhibitor activity	IDA	molecular function
GO:0015489	putrescine transmembrane transporter activity	ISS	molecular function
GO:0015847	putrescine transport	IEA	biological process
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0045732	positive regulation of protein catabolic process	ISS	biological process
GO:0072562	blood microparticle	IDA	cellular component
GO:1902268	negative regulation of polyamine transmembrane transport	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006521	regulation of cellular amino acid metabolic process	TAS	biological process
GO:0007283	spermatogenesis	TAS	biological process
GO:0008073	ornithine decarboxylase inhibitor activity	ISS	molecular function
GO:0008073	ornithine decarboxylase inhibitor activity	TAS	molecular function
GO:0008073	ornithine decarboxylase inhibitor activity	IDA	molecular function
GO:0015489	putrescine transmembrane transporter activity	ISS	molecular function
GO:0045732	positive regulation of protein catabolic process	ISS	biological process
GO:0072562	blood microparticle	IDA	cellular component
GO:1902268	negative regulation of polyamine transmembrane transport	ISS	biological process

Diseases

Associated diseases	References
Male factor infertility	MIK: 16542438
Asthenozoospermia	MIK: 22353264
Asthenozoospermia	MIK: 22353264
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538
Male infertility	MIK: 16542438
Male infertility	MIK: 18367176
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
16542438	Male infertility	-239 A/G in the promoter, 4280 C/T, a missense polymorphism in exon 5		524 (192 infertile men, 48 men of known paternity, 34 African aborigines, 250 general population controls)	Male infertility
22353264	Asthenozoospermia				Male infertility	ANXA2 BRD2 OAZ3
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray
18367176	Male infertility				Male infertility	Microarray