• Gene id: 51673

Gene Summary

• Gene Symbol: TPPP3   Gene   UCSC   Ensembl
• Aliases: CGI-38, TPPP/p20, p20, p25gamma
• Gene name: tubulin polymerization promoting protein family member 3
• Alternate names: tubulin polymerization-promoting protein family member 3, brain specific protein,
• Gene location: 16q22.1 (121227608: 121131407)     Exons: 20     NC_000004.12
• OMIM: 616957

Protein Summary

• Protein general information: Q9BW30  
  • Name: Tubulin polymerization promoting protein family member 3 (TPPP/p20)
  • Length: 176  
  • Mass: 18985
  • Tissue specificity: Expressed in endometrium during the mid-secretory phase (LH + 7) (at protein level). {ECO
• Sequence:

  MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEF
  KKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAG
  RQDILDDSGYVSAYKNAGTYDAKVKK

• Structural information:
  • Interpro: IPR011992  IPR008907  IPR030795  
  • PDB: 2JRF
  • PDBsum: 2JRF
  • STRING: ENSP00000462435
• Other Databases: GeneCards:  TPPP3  Malacards:  TPPP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015631	tubulin binding	IBA	molecular function
GO:0046785	microtubule polymerization	IBA	biological process
GO:0032273	positive regulation of protein polymerization	IBA	biological process
GO:0005874	microtubule	IBA	colocalizes with
GO:0001578	microtubule bundle formation	IBA	biological process
GO:0015631	tubulin binding	IDA	molecular function
GO:0001578	microtubule bundle formation	IDA	biological process
GO:0007566	embryo implantation	ISS	biological process
GO:0046697	decidualization	IMP	biological process
GO:0015631	tubulin binding	IEA	molecular function
GO:0001578	microtubule bundle formation	IEA	biological process
GO:0046785	microtubule polymerization	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0007566	embryo implantation	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	colocalizes with
GO:0097427	microtubule bundle	IDA	colocalizes with

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)