• Gene id: 51669

Gene Summary

• Gene Symbol: SARAF   Gene   UCSC   Ensembl
• Aliases: FOAP-7, HSPC035, TMEM66, XTP3
• Gene name: store-operated calcium entry associated regulatory factor
• Alternate names: store-operated calcium entry-associated regulatory factor, HBV X-transactivated gene 3 protein, HBV XAg-transactivated protein 3, SARAF long isoform, SARAF short isoform, SOCE-associated regulatory factor, testicular secretory protein Li 59, transmembrane protei,
• Gene location: 8p12 (30083207: 30063002)     Exons: 7     NC_000008.11
• OMIM: 614768

Protein Summary

• Protein general information: Q96BY9  
  • Name: Store operated calcium entry associated regulatory factor (SARAF) (SOCE associated regulatory factor) (HBV X transactivated gene 3 protein) (HBV XAg transactivated protein 3) (Protein FOAP 7) (Transmembrane protein 66)
  • Length: 339  
  • Mass: 36975
  • Tissue specificity: Highly expressed in macrophages. {ECO
• Sequence:

  MAAACGPGAAGYCLLLGLHLFLLTAGPALGWNDPDRMLLRDVKALTLHYDRYTTSRRLDPIPQLKCVGGTAGCDS
  YTPKVIQCQNKGWDGYDVQWECKTDLDIAYKFGKTVVSCEGYESSEDQYVLRGSCGLEYNLDYTELGLQKLKESG
  KQHGFASFSDYYYKWSSADSCNMSGLITIVVLLGIAFVVYKLFLSDGQYSPPPYSEYPPFSHRYQRFTNSAGPPP
  PGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYP
  GTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR

• Structural information:
  • Interpro: IPR009567  
  • PDB: 6O2U 6O2V 6O2W
  • PDBsum: 6O2U 6O2V 6O2W
  • STRING: ENSP00000256255
• Other Databases: GeneCards:  SARAF  Malacards:  SARAF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0140268	endoplasmic reticulum-plasma membrane contact site	IDA	cellular component
GO:0030176	integral component of endoplasmic reticulum membrane	IDA	cellular component
GO:2001256	regulation of store-operated calcium entry	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030176	integral component of endoplasmic reticulum membrane	IEA	cellular component
GO:2001256	regulation of store-operated calcium entry	IEA	biological process
GO:0006816	calcium ion transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881