• Gene id: 51659

Gene Summary

• Gene Symbol: GINS2   Gene   UCSC   Ensembl
• Aliases: HSPC037, PSF2, Pfs2
• Gene name: GINS complex subunit 2
• Alternate names: DNA replication complex GINS protein PSF2, GINS complex subunit 2 (Psf2 homolog),
• Gene location: 16q24.1 (85688953: 85676197)     Exons: 5     NC_000016.10
• Gene summary(Entrez): The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4; MIM 610611), Psf1 (GINS1; MIM 610608), Psf2, and Psf3 (GINS3; MIM 610610). The formation of this complex is essential for the initiation of DNA replication in yeast and Xenopus egg extract
• OMIM: 601151

Protein Summary

• Protein general information: Q9Y248  
  • Name: DNA replication complex GINS protein PSF2 (GINS complex subunit 2)
  • Length: 185  
  • Mass: 21428
• Sequence:

  MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEKLEKMR
  DHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQEAHAKLDNLTL
  MEINTSGTFLTQALNHMYKLRTNLQPLESTQSQDF

• Structural information:
  • Interpro: IPR021151  IPR036224  IPR007257  
  • PDB: 2E9X 2EHO 2Q9Q
  • PDBsum: 2E9X 2EHO 2Q9Q
  • DIP: 29332
  • STRING: ENSP00000253462
• Other Databases: GeneCards:  GINS2  Malacards:  GINS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043138	3'-5' DNA helicase activity	IBA	contributes to
GO:0031298	replication fork protection complex	IBA	cellular component
GO:0000811	GINS complex	IBA	cellular component
GO:0000727	double-strand break repair via break-induced replication	IBA	biological process
GO:0006260	DNA replication	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006260	DNA replication	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006271	DNA strand elongation involved in DNA replication	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0032508	DNA duplex unwinding	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray