• Gene id: 51650

Gene Summary

• Gene Symbol: MRPS33   Gene   UCSC   Ensembl
• Aliases: CGI-139, MRP-S33, PTD003, S33mt
• Gene name: mitochondrial ribosomal protein S33
• Alternate names: 28S ribosomal protein S33, mitochondrial, mitochondrial small ribosomal subunit protein mS33,
• Gene location: 7q34 (141014951: 141002609)     Exons: 4     NC_000007.14
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611993

Protein Summary

• Protein general information: Q9Y291  
  • Name: 28S ribosomal protein S33, mitochondrial (MRP S33) (S33mt) (Mitochondrial small ribosomal subunit protein mS33)
  • Length: 106  
  • Mass: 12629
• Sequence:

  MSSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYRDEH
  QDFMDEQKRLKKLRGKEKPKKGEGKRAAKRK

• Structural information:
  • Interpro: IPR013219  
  • PDB: 3J9M 6NU2 6NU3
  • PDBsum: 3J9M 6NU2 6NU3
  • STRING: ENSP00000376732
• Other Databases: GeneCards:  MRPS33  Malacards:  MRPS33

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005763	mitochondrial small ribosomal subunit	NAS	cellular component
GO:0003735	structural constituent of ribosome	NAS	molecular function
GO:0006412	translation	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881