• Gene id: 51647

Gene Summary

• Gene Symbol: CIAO2B   Gene   UCSC   Ensembl
• Aliases: CGI-128, CIA2B, FAM96B, MIP18
• Gene name: cytosolic iron-sulfur assembly component 2B
• Alternate names: cytosolic iron-sulfur assembly component 2B, MSS19-interacting protein of 18 kDa, family with sequence similarity 96 member B, mitotic spindle-associated MMXD complex subunit MIP18,
• Gene location: 16q22.1 (66934401: 66932064)     Exons: 4     NC_000016.10
• OMIM: 614778

Protein Summary

• Protein general information: Q9Y3D0  
  • Name: Cytosolic iron sulfur assembly component 2B (MSS19 interacting protein of 18 kDa) (Mitotic spindle associated MMXD complex subunit MIP18) (Protein FAM96B)
  • Length: 163  
  • Mass: 17663
• Sequence:

  MVGGGGVGGGLLENANPLIYQRSGERPVTAGEEDEQVPDSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRVQV
  SDPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKERVAAALENTH
  LLEVVNQCLSARS

• Structural information:
  • Interpro: IPR034904  IPR039796  IPR002744  
  • STRING: ENSP00000387471
• Other Databases: GeneCards:  CIAO2B  Malacards:  CIAO2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016226	iron-sulfur cluster assembly	IBA	biological process
GO:0097361	CIA complex	IBA	cellular component
GO:0097361	CIA complex	IDA	cellular component
GO:0097361	CIA complex	IDA	cellular component
GO:0071817	MMXD complex	IDA	cellular component
GO:0005819	spindle	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0097361	CIA complex	IDA	cellular component
GO:0097361	CIA complex	IDA	cellular component
GO:0016226	iron-sulfur cluster assembly	IMP	biological process
GO:0097428	protein maturation by iron-sulfur cluster transfer	IMP	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0106035	protein maturation by [4Fe-4S] cluster transfer	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007059	chromosome segregation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030496	midbody	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)