• Gene id: 51637

Gene Summary

• Gene Symbol: RTRAF   Gene   UCSC   Ensembl
• Aliases: C14orf166, CGI-99, CGI99, CLE, CLE7, LCRP369, RLLM1, hCLE, hCLE1
• Gene name: RNA transcription, translation and transport factor
• Alternate names: RNA transcription, translation and transport factor protein, CLE7 homolog, RLL motif containing 1, UPF0568 protein C14orf166,
• Gene location: 14q22.1 (51989545: 52010693)     Exons: 8     NC_000014.9
• OMIM: 610858

Protein Summary

• Protein general information: Q9Y224  
  • Name: RNA transcription, translation and transport factor protein (CLE7 homolog) (CLE) (hCLE)
  • Length: 244  
  • Mass: 28068
  • Tissue specificity: Widely expressed. Expressed at high level in heart and skeletal muscle. Expressed at intermediate level in liver, pancreas, fetal brain and fetal lung. Weakly expressed in adult brain, adult lung, placenta, fetal liver and fetal kidney
• Sequence:

  MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQD
  RQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYL
  VMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVA
  VQAIIADPKTDHRLGKVGR

• Structural information:
  • Interpro: IPR019265  
  • STRING: ENSP00000261700
• Other Databases: GeneCards:  RTRAF  Malacards:  RTRAF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0072669	tRNA-splicing ligase complex	IDA	cellular component
GO:0072669	tRNA-splicing ligase complex	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0000993	RNA polymerase II complex binding	IDA	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0006388	tRNA splicing, via endonucleolytic cleavage and ligation	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0050658	RNA transport	TAS	biological process
GO:0006469	negative regulation of protein kinase activity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016032	viral process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006388	tRNA splicing, via endonucleolytic cleavage and ligation	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)