• Gene id: 51635

Gene Summary

• Gene Symbol: DHRS7   Gene   UCSC   Ensembl
• Aliases: CGI-86, SDR34C1, retDSR4, retSDR4
• Gene name: dehydrogenase/reductase 7
• Alternate names: dehydrogenase/reductase SDR family member 7, dehydrogenase/reductase (SDR family) member 7, retinal short-chain dehydrogenase/reductase 4, short chain dehydrogenase/reductase family 34C member 1,
• Gene location: 14q23.1 (60169863: 60144118)     Exons: 8     NC_000014.9
• Gene summary(Entrez): This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family, which has over 46,000 members. Members in this family are enzymes that metabolize many different compounds, such as steroid hormones, prostaglandins, retinoids, lipids a
• OMIM: 612833

Protein Summary

• Protein general information: Q9Y394  
  • Name: Dehydrogenase/reductase SDR family member 7 (EC 1.1. . ) (Retinal short chain dehydrogenase/reductase 4) (retSDR4) (Short chain dehydrogenase/reductase family 34C member 1)
  • Length: 339  
  • Mass: 38299
• Sequence:

  MNWELLLWLLVLCALLLLLVQLLRFLRADGDLTLLWAEWQGRRPEWELTDMVVWVTGASSGIGEELAYQLSKLGV
  SLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDT
  SLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYP
  GIIVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMANDLKEVWISEQPFLLVTYLWQY
  MPTWAWWITNKMGKKRIENFKSGVDADSSYFKIFKTKHD

• Structural information:
  • Interpro: IPR036291  IPR020904  IPR002347  
  • Prosite: PS00061
  • STRING: ENSP00000216500
• Other Databases: GeneCards:  DHRS7  Malacards:  DHRS7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R