• Gene id: 51631

Gene Summary

• Gene Symbol: LUC7L2   Gene   UCSC   Ensembl
• Aliases: CGI-59, CGI-74, LUC7B2
• Gene name: LUC7 like 2, pre-mRNA splicing factor
• Alternate names: putative RNA-binding protein Luc7-like 2, LUC7-like 2,
• Gene location: 7q34 (139340358: 139423456)     Exons: 13     NC_000007.14
• Gene summary(Entrez): This gene encodes a protein that contains a C2H2-type zinc finger, coiled-coil region and arginine, serine-rich (RS) domain. A similar protein in mouse interacts with sodium channel modifier 1, and the encoded protein may be involved in the recognition of
• OMIM: 613056

Protein Summary

• Protein general information: Q9Y383  
  • Name: Putative RNA binding protein Luc7 like 2
  • Length: 392  
  • Mass: 46514
• Sequence:

  MSAQAQMRAMLDQLMGTSRDGDTTRQRIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRADYEIAS
  KEQDFFFELDAMDHLQSFIADCDRRTEVAKKRLAETQEEISAEVAAKAERVHELNEEIGKLLAKVEQLGAEGNVE
  ESQKVMDEVEKARAKKREAEEVYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKL
  EELKRVVAEKQEKRNQERLKRREEREREEREKLRRSRSHSKNPKRSRSREHRRHRSRSMSRERKRRTRSKSREKR
  HRHRSRSSSRSRSRSHQRSRHSSRDRSRERSKRRSSKERFRDQDLASCDRDRSSRDRSPRDRDRKDKKRSYESAN
  GRSEDRRSSEEREAGEI

• Structural information:
  • Interpro: IPR004882  
  • DIP: 32513
  • STRING: ENSP00000347005
• Other Databases: GeneCards:  LUC7L2  Malacards:  LUC7L2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003729	mRNA binding	IBA	molecular function
GO:0006376	mRNA splice site selection	IBA	biological process
GO:0005685	U1 snRNP	IBA	cellular component
GO:0071004	U2-type prespliceosome	IBA	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0016607	nuclear speck	ISS	cellular component
GO:0003729	mRNA binding	IEA	molecular function
GO:0006376	mRNA splice site selection	IEA	biological process
GO:0005685	U1 snRNP	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray