• Gene id: 51629

Gene Summary

• Gene Symbol: SLC25A39   Gene   UCSC   Ensembl
• Aliases: CGI-69, CGI69
• Gene name: solute carrier family 25 member 39
• Alternate names: solute carrier family 25 member 39,
• Gene location: 17q21.31 (44324869: 44319624)     Exons: 11     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the SLC25 transporter or mitochondrial carrier family of proteins. Members of this family are encoded by the nuclear genome while their protein products are usually embedded in the inner mitochondrial membrane and exhibit wid
• OMIM: 607714

Protein Summary

• Protein general information: Q9BZJ4  
  • Name: Solute carrier family 25 member 39
  • Length: 359  
  • Mass: 39249
  • Tissue specificity: Expressed in many tissues. Abundant in testis and kidney. {ECO
• Sequence:

  MADQDPAGISPLQQMVASGTGAVVTSLFMTPLDVVKVRLQSQRPSMASELMPSSRLWSLSYTKLPSSLQSTGKCL
  LYCNGVLEPLYLCPNGARCATWFQDPTRFTGTMDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKA
  FLCGRALTSDLYAPMVAGALARLGTVTVISPLELMRTKLQAQHVSYRELGACVRTAVAQGGWRSLWLGWGPTALR
  DVPFSALYWFNYELVKSWLNGFRPKDQTSVGMSFVAGGISGTVAAVLTLPFDVVKTQRQVALGAMEAVRVNPLHV
  DSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEFGKSFFQRLNQDRLLGG

• Structural information:
  • Interpro: IPR018108  IPR023395  
  • Prosite: PS50920
  • STRING: ENSP00000366299
• Other Databases: GeneCards:  SLC25A39  Malacards:  SLC25A39

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006783	heme biosynthetic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006783	heme biosynthetic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881