• Gene id: 51626

Gene Summary

• Gene Symbol: DYNC2LI1   Gene   UCSC   Ensembl
• Aliases: CGI-60, D2LIC, LIC3
• Gene name: dynein cytoplasmic 2 light intermediate chain 1
• Alternate names: cytoplasmic dynein 2 light intermediate chain 1,
• Gene location: 2p21 (43774038: 43828319)     Exons: 15     NC_000002.12
• Gene summary(Entrez): This gene encodes a protein that is a component of the dynein-2 microtubule motor protein complex that plays a role in the retrograde transport of cargo in primary cilia via the intraflagellar transport system. This gene is ubiquitously expressed and its
• OMIM: 617083

Protein Summary

• Protein general information: Q8TCX1  
  • Name: Cytoplasmic dynein 2 light intermediate chain 1 (Dynein 2 light intermediate chain)
  • Length: 351  
  • Mass: 39625
  • Tissue specificity: Expressed in bone, brain, kidney, and cartilage (PubMed
• Sequence:

  MPSETLWEIAKAEVEKRGINGSEGDGAEIAEKFVFFIGSKNGGKTTIILRCLDRDEPPKPTLALEYTYGRRAKGH
  NTPKDIAHFWELGGGTSLLDLISIPITGDTLRTFSLVLVLDLSKPNDLWPTMENLLQATKSHVDKVIMKLGKTNA
  KAVSEMRQKIWNNMPKDHPDHELIDPFPVPLVIIGSKYDVFQDFESEKRKVICKTLRFVAHYYGASLMFTSKSEA
  LLLKIRGVINQLAFGIDKSKSICVDQNKPLFITAGLDSFGQIGSPPVPENDIGKLHAHSPMELWKKVYEKLFPPK
  SINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQIELDS

• Structural information:
  • Interpro: IPR040045  IPR022780  IPR027417  
  • PDB: 6RLB 6SC2
  • PDBsum: 6RLB 6SC2
  • STRING: ENSP00000474032
• Other Databases: GeneCards:  DYNC2LI1  Malacards:  DYNC2LI1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005868	cytoplasmic dynein complex	IBA	cellular component
GO:0005930	axoneme	IBA	cellular component
GO:0036064	ciliary basal body	IBA	cellular component
GO:0008569	ATP-dependent microtubule motor activity, minus-end-directed	IBA	contributes to
GO:0035721	intraciliary retrograde transport	IBA	biological process
GO:0035735	intraciliary transport involved in cilium assembly	IBA	biological process
GO:0045504	dynein heavy chain binding	IBA	molecular function
GO:0005813	centrosome	IDA	cellular component
GO:0036064	ciliary basal body	IDA	cellular component
GO:0035869	ciliary transition zone	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:1902017	regulation of cilium assembly	IMP	biological process
GO:0035735	intraciliary transport involved in cilium assembly	IMP	biological process
GO:0005868	cytoplasmic dynein complex	IEA	cellular component
GO:0035721	intraciliary retrograde transport	IEA	biological process
GO:0035735	intraciliary transport involved in cilium assembly	IEA	biological process
GO:0030030	cell projection organization	IEA	biological process
GO:0003774	motor activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0030286	dynein complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005929	cilium	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005929	cilium	TAS	cellular component
GO:0005929	cilium	TAS	cellular component
GO:0005929	cilium	TAS	cellular component
GO:0005929	cilium	TAS	cellular component
GO:0035735	intraciliary transport involved in cilium assembly	TAS	biological process
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0060271	cilium assembly	IEA	biological process
GO:0045177	apical part of cell	IEA	cellular component
GO:0030990	intraciliary transport particle	IEA	cellular component
GO:0005930	axoneme	IEA	cellular component
GO:0045504	dynein heavy chain binding	IEA	molecular function
GO:0031514	motile cilium	IEA	cellular component
GO:0007368	determination of left/right symmetry	IEA	biological process
GO:0005868	cytoplasmic dynein complex	ISS	cellular component
GO:0005930	axoneme	ISS	cellular component
GO:0030990	intraciliary transport particle	ISS	colocalizes with
GO:0036064	ciliary basal body	ISS	colocalizes with
GO:0045177	apical part of cell	ISS	cellular component
GO:0045177	apical part of cell	ISS	cellular component
GO:0005881	cytoplasmic microtubule	ISS	colocalizes with
GO:0031514	motile cilium	ISS	cellular component
GO:0005929	cilium	ISS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005868	cytoplasmic dynein complex	IDA	cellular component
GO:0008569	ATP-dependent microtubule motor activity, minus-end-directed	IDA	contributes to

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection
hsa04962	Vasopressin-regulated water reabsorption

Diseases

Associated diseases	References
Short-rib thoracic dysplasia	KEGG:H02157
Short-rib thoracic dysplasia	KEGG:H02157
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)