• Gene id: 51617

Gene Summary

• Gene Symbol: NSG2   Gene   UCSC   Ensembl
• Aliases: CALY3, HMP19
• Gene name: neuronal vesicle trafficking associated 2
• Alternate names: neuronal vesicle trafficking-associated protein 2, calcyon family member 3, hypothalamus golgi apparatus expressed 19 kDa protein, neuron-specific protein family member 2, p19 protein, protein p19,
• Gene location: 5q35.2 (174045705: 174109178)     Exons: 5     NC_000005.10
• OMIM: 0

Protein Summary

• Protein general information: Q9Y328  
  • Name: Neuronal vesicle trafficking associated protein 2 (Neuron specific protein family member 2) (Protein p19) (Hmp19)
  • Length: 171  
  • Mass: 19085
• Sequence:

  MVKLNSNPSEKGTKPPSVEDGFQTVPLITPLEVNHLQLPAPEKVIVKTRTEYQPEQKNKGKFRVPKIAEFTVTIL
  VSLALAFLACIVFLVVYKAFTYDHSCPEGFVYKHKRCIPASLDAYYSSQDPNSRSRFYTVISHYSVAKQSTARAI
  GPWLSAAAVIHEPKPPKTQGH

• Structural information:
  • Interpro: IPR009431  
  • STRING: ENSP00000307722
• Other Databases: GeneCards:  NSG2  Malacards:  NSG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IBA	cellular component
GO:0016197	endosomal transport	IBA	biological process
GO:0048268	clathrin coat assembly	IBA	biological process
GO:0005768	endosome	IBA	cellular component
GO:0032051	clathrin light chain binding	IBA	molecular function
GO:0032588	trans-Golgi network membrane	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0005768	endosome	ISS	cellular component
GO:1990674	Golgi cis cisterna membrane	ISS	cellular component
GO:0032585	multivesicular body membrane	ISS	cellular component
GO:0030659	cytoplasmic vesicle membrane	ISS	cellular component
GO:0005770	late endosome	ISS	cellular component
GO:0005769	early endosome	ISS	cellular component
GO:0007212	dopamine receptor signaling pathway	IEA	biological process
GO:0032051	clathrin light chain binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0048268	clathrin coat assembly	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043202	lysosomal lumen	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0032588	trans-Golgi network membrane	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:1990674	Golgi cis cisterna membrane	IEA	cellular component
GO:0032585	multivesicular body membrane	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0032585	multivesicular body membrane	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0043202	lysosomal lumen	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray