• Gene id: 51616

Gene Summary

• Gene Symbol: TAF9B   Gene   UCSC   Ensembl
• Aliases: DN-7, DN7, TAF9L, TAFII31L, TFIID-31
• Gene name: TATA-box binding protein associated factor 9b
• Alternate names: transcription initiation factor TFIID subunit 9B, TAF9-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa, TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa, TBP-associated factor 9L, neuronal cell d,
• Gene location: Xq21.1 (78139649: 78129747)     Exons: 7     NC_000023.11
• Gene summary(Entrez): Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly,
• OMIM: 300754

Protein Summary

• Protein general information: Q9HBM6  
  • Name: Transcription initiation factor TFIID subunit 9B (Neuronal cell death related protein 7) (DN 7) (Transcription initiation factor TFIID subunit 9 like) (Transcription associated factor TAFII31L)
  • Length: 251  
  • Mass: 27622
• Sequence:

  MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADDVRLAI
  QCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGA
  VSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPATTAVQNVLINPSMIGPKNILITTNM
  VSSQNTANEANPLKRKHEDDDDNDIM

• Structural information:
  • Interpro: IPR009072  IPR003162  
  • CDD: cd07979
  • STRING: ENSP00000339917
• Other Databases: GeneCards:  TAF9B  Malacards:  TAF9B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0016251	RNA polymerase II general transcription initiation factor activity	IC	molecular function
GO:0006366	transcription by RNA polymerase II	IBA	biological process
GO:0005669	transcription factor TFIID complex	IBA	cellular component
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0008134	transcription factor binding	IBA	molecular function
GO:0000124	SAGA complex	IBA	cellular component
GO:0006352	DNA-templated transcription, initiation	IEA	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016579	protein deubiquitination	TAS	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003714	transcription corepressor activity	IC	molecular function
GO:0050821	protein stabilization	IDA	biological process
GO:1902166	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IC	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0033276	transcription factor TFTC complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030307	positive regulation of cell growth	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03022	Basal transcription factors

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)