• Gene id: 51608

Gene Summary

• Gene Symbol: GET4   Gene   UCSC   Ensembl
• Aliases: C7orf20, CEE, CGI-20, TRC35
• Gene name: guided entry of tail-anchored proteins factor 4
• Alternate names: Golgi to ER traffic protein 4 homolog, H_NH1244M04.5, conserved edge expressed protein, conserved edge protein, golgi to ER traffic protein 4, transmembrane domain recognition complex 35 kDa subunit, transmembrane domain recognition complex, 35kDa,
• Gene location: 7p22.3 (876553: 896435)     Exons: 9     NC_000007.14
• OMIM: 612056

Protein Summary

• Protein general information: Q7L5D6  
  • Name: Golgi to ER traffic protein 4 homolog (Conserved edge expressed protein) (Transmembrane domain recognition complex 35 kDa subunit) (TRC35)
  • Length: 327  
  • Mass: 36504
• Sequence:

  MAAAAAMAEQESARNGGRNRGGVQRVEGKLRASVEKGDYYEAHQMYRTLFFRYMSQSKHTEARELMYSGALLFFS
  HGQQNSAADLSMLVLESLEKAEVEVADELLENLAKVFSLMDPNSPERVTFVSRALKWSSGGSGKLGHPRLHQLLA
  LTLWKEQNYCESRYHFLHSADGEGCANMLVEYSTSRGFRSEVDMFVAQAVLQFLCLKNKSSASVVFTTYTQKHPS
  IEDGPPFVEPLLNFIWFLLLAVDGGKLTVFTVLCEQYQPSLRRDPMYNEYLDRIGQLFFGVPPKQTSSYGGLLGN
  LLTSLMGSSEQEDGEESPSDGSPIELD

• Structural information:
  • Interpro: IPR007317  IPR011990  
  • PDB: 6AU8
  • PDBsum: 6AU8
  • STRING: ENSP00000265857
• Other Databases: GeneCards:  GET4  Malacards:  GET4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1904378	maintenance of unfolded protein involved in ERAD pathway	IMP	biological process
GO:0071818	BAT3 complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0051220	cytoplasmic sequestering of protein	IMP	biological process
GO:0045048	protein insertion into ER membrane	IBA	biological process
GO:0071818	BAT3 complex	IBA	cellular component
GO:0071818	BAT3 complex	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0071816	tail-anchored membrane protein insertion into ER membrane	IDA	biological process
GO:0071816	tail-anchored membrane protein insertion into ER membrane	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045048	protein insertion into ER membrane	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0071818	BAT3 complex	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq