• Gene id: 51605

Gene Summary

• Gene Symbol: TRMT6   Gene   UCSC   Ensembl
• Aliases: CGI-09, GCD10, Gcd10p
• Gene name: tRNA methyltransferase 6
• Alternate names: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6, mRNA methyladenosine-N(1)-methyltransferase non-catalytic subunit TRM6, tRNA methyltransferase 6 homolog, tRNA(m1A58)MTase subunit TRM6,
• Gene location: 20p12.3 (5950557: 5937227)     Exons: 11     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the tRNA methyltransferase 6 protein family. A similar protein in yeast is part of a two component methyltransferase, which is involved in the posttranslational modification that produces the modified nucleoside 1-methyladeno
• OMIM: 0

Protein Summary

• Protein general information: Q9UJA5  
  • Name: tRNA (adenine(58) N(1)) methyltransferase non catalytic subunit TRM6 (mRNA methyladenosine N(1) methyltransferase non catalytic subunit TRM6) (tRNA(m1A58) methyltransferase subunit TRM6) (tRNA(m1A58)MTase subunit TRM6)
  • Length: 497  
  • Mass: 55799
  • Tissue specificity: Expressed in brain, liver, testis and ovary. {ECO
• Sequence:

  MEGSGEQPGPQPQHPGDHRIRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTAFEVTSGGSLQ
  PKKKREEPTAETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLIENSTTFRDKTEFAQDKYIKKK
  KKKYEAIITVVKPSTRILSIMYYAREPGKINHMRYDTLAQMLTLGNIRAGNKMIVMETCAGLVLGAMMERMGGFG
  SIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDSLLHGTFSAKMLSSEPKDSALVEESNGTLEEKQASEQ
  ENEDSMAEAPESNHPEDQETMETISQDPEHKGPKERGSKKDYIQEKQRRQEEQRKRHLEAAALLSERNADGLIVA
  SRFHPTPLLLSLLDFVAPSRPFVVYCQYKEPLLECYTKLRERGGVINLRLSETWLRNYQVLPDRSHPKLLMSGGG
  GYLLSGFTVAMDNLKADTSLKSNASTLESHETEEPAAKKRKCPESDS

• Structural information:
  • Interpro: IPR017423  
  • PDB: 5CCB 5CCX 5CD1
  • PDBsum: 5CCB 5CCX 5CD1
  • STRING: ENSP00000203001
• Other Databases: GeneCards:  TRMT6  Malacards:  TRMT6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031515	tRNA (m1A) methyltransferase complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0080009	mRNA methylation	IDA	biological process
GO:0080009	mRNA methylation	IDA	biological process
GO:0030488	tRNA methylation	IEA	biological process
GO:0031515	tRNA (m1A) methyltransferase complex	IEA	cellular component
GO:0008033	tRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006400	tRNA modification	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray