• Gene id: 51602

Gene Summary

• Gene Symbol: NOP58   Gene   UCSC   Ensembl
• Aliases: HSPC120, NOP5, NOP5/NOP58
• Gene name: NOP58 ribonucleoprotein
• Alternate names: nucleolar protein 58, NOP58 ribonucleoprotein homolog, nucleolar protein 5, nucleolar protein NOP5/NOP58,
• Gene location: 2q33.1 (23916544: 23924630)     Exons: 5     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a core component of box C/D small nucleolar ribonucleoproteins. Some box C/D small nucleolar RNAs (snoRNAs), such as U3, U8, and U14, are dependent upon the encoded protein for their synthesis. This protein is SUMOylate
• OMIM: 616742

Protein Summary

• Protein general information: Q9Y2X3  
  • Name: Nucleolar protein 58 (Nucleolar protein 5)
  • Length: 529  
  • Mass: 59578
  • Tissue specificity: Ubiquitous.
• Sequence:

  MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAFTALMEGKINKQLKKV
  LKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPVVNELMRGIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYR
  LKFSADKVDTMIVQAISLLDDLDKELNNYIMRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASAKLSEL
  LPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMVGELVGARLIA
  HAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAF
  GEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEQVDK
  EDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKRGKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKR
  ENED

• Structural information:
  • Protein Domains: (282..40-)
    (/note="Nop-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00690"-)
  • Interpro: IPR029012  IPR012974  IPR042239  IPR002687  IPR036070   IPR012976  
  • Prosite: PS51358
  • DIP: 32926
  • STRING: ENSP00000264279
• Other Databases: GeneCards:  NOP58  Malacards:  NOP58

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030515	snoRNA binding	IBA	molecular function
GO:0031428	box C/D snoRNP complex	IBA	cellular component
GO:0032040	small-subunit processome	IBA	cellular component
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006364	rRNA processing	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0030515	snoRNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0070761	pre-snoRNP complex	IDA	cellular component
GO:0005732	small nucleolar ribonucleoprotein complex	IDA	cellular component
GO:0015030	Cajal body	IDA	cellular component
GO:0031428	box C/D snoRNP complex	NAS	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005730	nucleolus	TAS	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0006364	rRNA processing	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0048254	snoRNA localization	IMP	biological process
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001094	TFIID-class transcription factor complex binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray