• Gene id: 51599

Gene Summary

• Gene Symbol: LSR   Gene   UCSC   Ensembl
• Aliases: ILDR3, LISCH7
• Gene name: lipolysis stimulated lipoprotein receptor
• Alternate names: lipolysis-stimulated lipoprotein receptor, LISCH protein, immunoglobulin-like domain containing receptor 3, lipolysis-stimulated remnant, liver-specific bHLH-Zip transcription factor,
• Gene location: 19q13.12 (35248655: 35267963)     Exons: 10     NC_000019.10
• OMIM: 616582

Protein Summary

• Protein general information: Q86X29  
  • Name: Lipolysis stimulated lipoprotein receptor
  • Length: 649  
  • Mass: 71439
• Sequence:

  MQQDGLGVGTRNGSGKGRSVHPSWPWCAPRPLRYFGRDARARRAQTAAMALLAGGLSRGLGSHPAAAGRDAVVFV
  WLLLSTWCTAPARAIQVTVSNPYHVVILFQPVTLPCTYQMTSTPTQPIVIWKYKSFCRDRIADAFSPASVDNQLN
  AQLAAGNPGYNPYVECQDSVRTVRVVATKQGNAVTLGDYYQGRRITITGNADLTFDQTAWGDSGVYYCSVVSAQD
  LQGNNEAYAELIVLGRTSGVAELLPGFQAGPIEDWLFVVVVCLAAFLIFLLLGICWCQCCPHTCCCYVRCPCCPD
  KCCCPEALYAAGKAATSGVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYNGYPGGYPGDVDRSSSAGGQGSYVPL
  LRDTDSSVASEVRSGYRIQASQQDDSMRVLYYMEKELANFDPSRPGPPSGRVERAMSEVTSLHEDDWRSRPSRGP
  ALTPIRDEEWGGHSPRSPRGWDQEPAREQAGGGWRARRPRARSVDALDDLTPPSTAESGSRSPTSNGGRSRAYMP
  PRSRSRDDLYDQDDSRDFPRSRDPHYDDFRSRERPPADPRSHHHRTRDPRDNGSRSGDLPYDGRLLEEAVRKKGS
  EERRRPHKEEEEEAYYPPAPPPYSETDSQASRERRLKKNLALSRESLVV

• Structural information:
  • Protein Domains: (86..23-)
    (/note="Ig-like-V-type")
  • Interpro: IPR007110  IPR036179  IPR003599  IPR008664  
  • Prosite: PS50835
  • STRING: ENSP00000480821
• Other Databases: GeneCards:  LSR  Malacards:  LSR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061833	protein localization to tricellular tight junction	ISS	biological process
GO:1904274	tricellular tight junction assembly	ISS	biological process
GO:0035633	maintenance of blood-brain barrier	NAS	biological process
GO:0061689	tricellular tight junction	ISS	cellular component
GO:0060856	establishment of blood-brain barrier	ISS	biological process
GO:0061436	establishment of skin barrier	ISS	biological process
GO:0034362	low-density lipoprotein particle	IEA	cellular component
GO:0042627	chylomicron	IEA	cellular component
GO:0034361	very-low-density lipoprotein particle	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0001889	liver development	ISS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:1904274	tricellular tight junction assembly	IEA	biological process
GO:0019216	regulation of lipid metabolic process	IEA	biological process
GO:0001889	liver development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0060856	establishment of blood-brain barrier	IEA	biological process
GO:0061436	establishment of skin barrier	IEA	biological process
GO:0061689	tricellular tight junction	IEA	cellular component
GO:0061833	protein localization to tricellular tight junction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R