• Gene id: 51588

Gene Summary

• Gene Symbol: PIAS4   Gene   UCSC   Ensembl
• Aliases: PIAS-gamma, PIASY, Piasg, ZMIZ6
• Gene name: protein inhibitor of activated STAT 4
• Alternate names: E3 SUMO-protein ligase PIAS4, RING-type E3 ubiquitin transferase PIAS4, protein inhibitor of activated STAT protein 4, protein inhibitor of activated STAT protein PIASy, protein inhibitor of activated STAT protein gamma, zinc finger, MIZ-type containing 6,
• Gene location: 19p13.3 (4007735: 4039385)     Exons: 12     NC_000019.10
• OMIM: 180072

Protein Summary

• Protein general information: Q8N2W9  
  • Name: E3 SUMO protein ligase PIAS4 (EC 2.3.2.27) (PIASy) (Protein inhibitor of activated STAT protein 4) (Protein inhibitor of activated STAT protein gamma) (PIAS gamma) (RING type E3 ubiquitin transferase PIAS4)
  • Length: 510  
  • Mass: 56504
  • Tissue specificity: Highly expressed in testis and, at lower levels, in spleen, prostate, ovary, colon and peripheral blood leukocytes. {ECO
• Sequence:

  MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKELYETRYAKKNSEPAP
  QPHRPLDPLTMHSTYDRAGAVPRTPLAGPNIDYPVLYGKYLNGLGRLPAKTLKPEVRLVKLPFFNMLDELLKPTE
  LVPQNNEKLQESPCIFALTPRQVELIRNSRELQPGVKAVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPG
  YYPSNKPGVEPKRPCRPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSELLQRLKTIGVKHPELCK
  ALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYD
  QLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGG
  GPVGSMENGKPGADVVDLTLDSSSSSEDEEEEEEEEEDEDEEGPRPKRRCPFQKGLVPAC

• Structural information:
  • Protein Domains: (12..4-)
    (/note="SAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00186-)
    (119..27-)
    (/note="PINIT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00799"-)
  • Interpro: IPR027224  IPR023321  IPR038654  IPR003034  IPR036361   IPR004181  IPR013083  
  • Prosite: PS51466 PS50800 PS51044
  • DIP: 32499
  • STRING: ENSP00000262971
• Other Databases: GeneCards:  PIAS4  Malacards:  PIAS4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001085	RNA polymerase II transcription factor binding	IBA	molecular function
GO:0061665	SUMO ligase activity	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003712	transcription coregulator activity	IBA	molecular function
GO:0016925	protein sumoylation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0033235	positive regulation of protein sumoylation	IDA	biological process
GO:0019789	SUMO transferase activity	IMP	molecular function
GO:0016925	protein sumoylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0019789	SUMO transferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0019789	SUMO transferase activity	EXP	molecular function
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006303	double-strand break repair via nonhomologous end joining	TAS	biological process
GO:0019789	SUMO transferase activity	TAS	molecular function
GO:0019789	SUMO transferase activity	TAS	molecular function
GO:0042359	vitamin D metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IEA	cellular component
GO:0010804	negative regulation of tumor necrosis factor-mediated signaling pathway	IEA	biological process
GO:0016363	nuclear matrix	IEA	cellular component
GO:0019789	SUMO transferase activity	IEA	molecular function
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0061665	SUMO ligase activity	IEA	molecular function
GO:1902231	positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IEA	biological process
GO:1990234	transferase complex	IEA	cellular component
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016925	protein sumoylation	IEA	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:1902174	positive regulation of keratinocyte apoptotic process	IEA	biological process
GO:0061665	SUMO ligase activity	IDA	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:1902174	positive regulation of keratinocyte apoptotic process	ISS	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016605	PML body	IEA	cellular component
GO:0016925	protein sumoylation	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0033235	positive regulation of protein sumoylation	IDA	biological process
GO:0005634	nucleus	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	NAS	biological process
GO:0008270	zinc ion binding	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis
hsa04630	JAK-STAT signaling pathway
hsa05418	Fluid shear stress and atherosclerosis
hsa04064	NF-kappa B signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq