• Gene id: 51582

Gene Summary

• Gene Symbol: AZIN1   Gene   UCSC   Ensembl
• Aliases: AZI, AZI1, AZIA1, OAZI, OAZIN, ODC1L
• Gene name: antizyme inhibitor 1
• Alternate names: antizyme inhibitor 1, ornithine decarboxylase antizyme inhibitor,
• Gene location: 8q22.3 (102864199: 102826301)     Exons: 22     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the antizyme inhibitor family, which plays a role in cell growth and proliferation by maintaining polyamine homeostasis within the cell. Antizyme inhibitors are homologs of ornithine decarboxylase (ODC, the key
• OMIM: 607909

Protein Summary

• Protein general information: O14977  
  • Name: Antizyme inhibitor 1 (AZI) (AZI1) (Ornithine decarboxylase antizyme inhibitor)
  • Length: 448  
  • Mass: 49535
  • Tissue specificity: Expressed in liver. {ECO
• Sequence:

  MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQNVVAQIKPFYTVKCNSAPA
  VLEILAALGTGFACSSKNEMALVQELGVPPENIIYISPCKQVSQIKYAAKVGVNILTCDNEIELKKIARNHPNAK
  VLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQVYVHALSDARCVFDMAGEI
  GFTMNMLDIGGGFTGTEFQLEEVNHVISPLLDIYFPEGSGVKIISEPGSYYVSSAFTLAVNIIAKKVVENDKFPS
  GVEKTGSDEPAFMYYMNDGVYGSFASKLSEDLNTIPEVHKKYKEDEPLFTSSLWGPSCDELDQIVESCLLPELNV
  GDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSDWYEMQDAGITSDSMMKNFFFVPSCIQLSQEDSFSAEA

• Structural information:
  • Interpro: IPR009006  IPR031178  IPR022643  IPR022657  IPR022644   IPR000183  IPR002433  IPR029066  
  • Prosite: PS00879
  • PDB: 4ZGZ
  • PDBsum: 4ZGZ
  • STRING: ENSP00000337180
• Other Databases: GeneCards:  AZIN1  Malacards:  AZIN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1902269	positive regulation of polyamine transmembrane transport	IBA	biological process
GO:0042177	negative regulation of protein catabolic process	IBA	biological process
GO:0004586	ornithine decarboxylase activity	IBA	molecular function
GO:0042978	ornithine decarboxylase activator activity	IBA	molecular function
GO:0033387	putrescine biosynthetic process from ornithine	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:1902269	positive regulation of polyamine transmembrane transport	IDA	biological process
GO:0042177	negative regulation of protein catabolic process	IDA	biological process
GO:0042978	ornithine decarboxylase activator activity	IDA	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0006596	polyamine biosynthetic process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0042978	ornithine decarboxylase activator activity	IEA	molecular function
GO:0006596	polyamine biosynthetic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006521	regulation of cellular amino acid metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902269	positive regulation of polyamine transmembrane transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0042978	ornithine decarboxylase activator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process

Diseases

Associated diseases	References
Esophagus squamous cell carcinoma	PMID:24302582
hepatocellular carcinoma	PMID:23291631
Cryptorchidism	MIK: 21412036
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21412036	Cryptorchidism			23 (4 controls, 19 cases)	Male infertility	GSE25518 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray