• Gene id: 51561

Gene Summary

• Gene Symbol: IL23A   Gene   UCSC   Ensembl
• Aliases: IL-23, IL-23A, IL23P19, P19, SGRF
• Gene name: interleukin 23 subunit alpha
• Alternate names: interleukin-23 subunit alpha, IL-23 subunit alpha, IL-23-A, IL-23p19, JKA3 induced upon T-cell activation, interleukin 23 p19 subunit, interleukin 23, alpha subunit p19, interleukin-23 subunit p19, interleukin-six, G-CSF related factor,
• Gene location: 12q13.3 (56334158: 56340409)     Exons: 6     NC_000012.12
• Gene summary(Entrez): This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific su
• OMIM: 605580

Protein Summary

• Protein general information: Q9NPF7  
  • Name: Interleukin 23 subunit alpha (IL 23 subunit alpha) (IL 23 A) (Interleukin 23 subunit p19) (IL 23p19)
  • Length: 189  
  • Mass: 20,730
  • Tissue specificity: Ubiquitous.
• Sequence:

  MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGD
  GCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSL
  SPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

• Structural information:
  • Interpro: IPR009079  IPR010831  
  • PDB: 3D85 3D87 3DUH 3QWR 4GRW 5MJ3 5MJ4 5MXA 5MZV 5NJD
  • PDBsum: 3D85 3D87 3DUH 3QWR 4GRW 5MJ3 5MJ4 5MXA 5MZV 5NJD
  • STRING: ENSP00000228534
• Other Databases: GeneCards:  IL23A  Malacards:  IL23A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001916	positive regulation of T cell mediated cytotoxicity	ISS	biological process
GO:0002230	positive regulation of defense response to virus by host	ISS	biological process
GO:0002230	positive regulation of defense response to virus by host	IDA	biological process
GO:0002827	positive regulation of T-helper 1 type immune response	ISS	biological process
GO:0002827	positive regulation of T-helper 1 type immune response	IDA	biological process
GO:0002827	positive regulation of T-helper 1 type immune response	TAS	biological process
GO:0002827	positive regulation of T-helper 1 type immune response	NAS	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0010535	positive regulation of activation of JAK2 kinase activity	IDA	biological process
GO:0032693	negative regulation of interleukin-10 production	IMP	biological process
GO:0032725	positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	TAS	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032733	positive regulation of interleukin-10 production	IDA	biological process
GO:0032733	positive regulation of interleukin-10 production	TAS	biological process
GO:0032735	positive regulation of interleukin-12 production	IDA	biological process
GO:0032740	positive regulation of interleukin-17 production	IDA	biological process
GO:0032740	positive regulation of interleukin-17 production	IDA	biological process
GO:0032740	positive regulation of interleukin-17 production	IDA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IMP	biological process
GO:0032816	positive regulation of natural killer cell activation	IC	biological process
GO:0032819	positive regulation of natural killer cell proliferation	IDA	biological process
GO:0034105	positive regulation of tissue remodeling	IC	biological process
GO:0042098	T cell proliferation	IEA	biological process
GO:0042102	positive regulation of T cell proliferation	IDA	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0042346	positive regulation of NF-kappaB import into nucleus	TAS	biological process
GO:0042510	regulation of tyrosine phosphorylation of Stat1 protein	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0042520	positive regulation of tyrosine phosphorylation of Stat4 protein	IDA	biological process
GO:0042520	positive regulation of tyrosine phosphorylation of Stat4 protein	IDA	biological process
GO:0042520	positive regulation of tyrosine phosphorylation of Stat4 protein	IDA	biological process
GO:0042523	positive regulation of tyrosine phosphorylation of Stat5 protein	IDA	biological process
GO:0043382	positive regulation of memory T cell differentiation	ISS	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0045672	positive regulation of osteoclast differentiation	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0048771	tissue remodeling	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IC	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0051135	positive regulation of NK T cell activation	IDA	biological process
GO:0051135	positive regulation of NK T cell activation	IC	biological process
GO:0051142	positive regulation of NK T cell proliferation	IDA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0070743	interleukin-23 complex	IDA	cellular component
GO:0090023	positive regulation of neutrophil chemotaxis	IEA	biological process
GO:2000318	positive regulation of T-helper 17 type immune response	ISS	biological process
GO:2000330	positive regulation of T-helper 17 cell lineage commitment	ISS	biological process
GO:2000330	positive regulation of T-helper 17 cell lineage commitment	IBA	biological process
GO:0045519	interleukin-23 receptor binding	IDA	molecular function
GO:0001916	positive regulation of T cell mediated cytotoxicity	IEA	biological process
GO:0001916	positive regulation of T cell mediated cytotoxicity	ISS	biological process
GO:0002230	positive regulation of defense response to virus by host	IEA	biological process
GO:0002230	positive regulation of defense response to virus by host	ISS	biological process
GO:0002230	positive regulation of defense response to virus by host	IDA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0002827	positive regulation of T-helper 1 type immune response	IEA	biological process
GO:0002827	positive regulation of T-helper 1 type immune response	ISS	biological process
GO:0002827	positive regulation of T-helper 1 type immune response	IDA	biological process
GO:0002827	positive regulation of T-helper 1 type immune response	TAS	biological process
GO:0002827	positive regulation of T-helper 1 type immune response	NAS	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0010535	positive regulation of activation of JAK2 kinase activity	IDA	biological process
GO:0032693	negative regulation of interleukin-10 production	IMP	biological process
GO:0032725	positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	TAS	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032733	positive regulation of interleukin-10 production	IDA	biological process
GO:0032733	positive regulation of interleukin-10 production	TAS	biological process
GO:0032735	positive regulation of interleukin-12 production	IDA	biological process
GO:0032740	positive regulation of interleukin-17 production	IDA	biological process
GO:0032740	positive regulation of interleukin-17 production	IDA	biological process
GO:0032740	positive regulation of interleukin-17 production	IDA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IMP	biological process
GO:0032816	positive regulation of natural killer cell activation	IC	biological process
GO:0032819	positive regulation of natural killer cell proliferation	IDA	biological process
GO:0034105	positive regulation of tissue remodeling	IC	biological process
GO:0042098	T cell proliferation	IEA	biological process
GO:0042102	positive regulation of T cell proliferation	IDA	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0042346	positive regulation of NF-kappaB import into nucleus	TAS	biological process
GO:0042510	regulation of tyrosine phosphorylation of Stat1 protein	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0042520	positive regulation of tyrosine phosphorylation of Stat4 protein	IDA	biological process
GO:0042520	positive regulation of tyrosine phosphorylation of Stat4 protein	IDA	biological process
GO:0042520	positive regulation of tyrosine phosphorylation of Stat4 protein	IDA	biological process
GO:0042523	positive regulation of tyrosine phosphorylation of Stat5 protein	IDA	biological process
GO:0043382	positive regulation of memory T cell differentiation	IEA	biological process
GO:0043382	positive regulation of memory T cell differentiation	ISS	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0045519	interleukin-23 receptor binding	IEA	molecular function
GO:0045672	positive regulation of osteoclast differentiation	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0048771	tissue remodeling	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IC	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0051135	positive regulation of NK T cell activation	IDA	biological process
GO:0051135	positive regulation of NK T cell activation	IC	biological process
GO:0051142	positive regulation of NK T cell proliferation	IDA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0070743	interleukin-23 complex	IEA	cellular component
GO:0070743	interleukin-23 complex	IDA	cellular component
GO:0090023	positive regulation of neutrophil chemotaxis	IEA	biological process
GO:2000318	positive regulation of T-helper 17 type immune response	IEA	biological process
GO:2000318	positive regulation of T-helper 17 type immune response	ISS	biological process
GO:2000330	positive regulation of T-helper 17 cell lineage commitment	IEA	biological process
GO:2000330	positive regulation of T-helper 17 cell lineage commitment	ISS	biological process
GO:2000330	positive regulation of T-helper 17 cell lineage commitment	IBA	biological process
GO:0045519	interleukin-23 receptor binding	IDA	molecular function
GO:0001916	positive regulation of T cell mediated cytotoxicity	ISS	biological process
GO:0002230	positive regulation of defense response to virus by host	ISS	biological process
GO:0002230	positive regulation of defense response to virus by host	IDA	biological process
GO:0002827	positive regulation of T-helper 1 type immune response	ISS	biological process
GO:0002827	positive regulation of T-helper 1 type immune response	IDA	biological process
GO:0002827	positive regulation of T-helper 1 type immune response	TAS	biological process
GO:0002827	positive regulation of T-helper 1 type immune response	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0010535	positive regulation of activation of JAK2 kinase activity	IDA	biological process
GO:0032693	negative regulation of interleukin-10 production	IMP	biological process
GO:0032725	positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	TAS	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032733	positive regulation of interleukin-10 production	IDA	biological process
GO:0032733	positive regulation of interleukin-10 production	TAS	biological process
GO:0032735	positive regulation of interleukin-12 production	IDA	biological process
GO:0032740	positive regulation of interleukin-17 production	IDA	biological process
GO:0032740	positive regulation of interleukin-17 production	IDA	biological process
GO:0032740	positive regulation of interleukin-17 production	IDA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IMP	biological process
GO:0032816	positive regulation of natural killer cell activation	IC	biological process
GO:0032819	positive regulation of natural killer cell proliferation	IDA	biological process
GO:0034105	positive regulation of tissue remodeling	IC	biological process
GO:0042102	positive regulation of T cell proliferation	IDA	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0042346	positive regulation of NF-kappaB import into nucleus	TAS	biological process
GO:0042510	regulation of tyrosine phosphorylation of Stat1 protein	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0042520	positive regulation of tyrosine phosphorylation of Stat4 protein	IDA	biological process
GO:0042520	positive regulation of tyrosine phosphorylation of Stat4 protein	IDA	biological process
GO:0042520	positive regulation of tyrosine phosphorylation of Stat4 protein	IDA	biological process
GO:0042523	positive regulation of tyrosine phosphorylation of Stat5 protein	IDA	biological process
GO:0043382	positive regulation of memory T cell differentiation	ISS	biological process
GO:0045672	positive regulation of osteoclast differentiation	IDA	biological process
GO:0050729	positive regulation of inflammatory response	IC	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0051135	positive regulation of NK T cell activation	IDA	biological process
GO:0051135	positive regulation of NK T cell activation	IC	biological process
GO:0051142	positive regulation of NK T cell proliferation	IDA	biological process
GO:0070743	interleukin-23 complex	IDA	cellular component
GO:2000318	positive regulation of T-helper 17 type immune response	ISS	biological process
GO:2000330	positive regulation of T-helper 17 cell lineage commitment	ISS	biological process
GO:2000330	positive regulation of T-helper 17 cell lineage commitment	IBA	biological process
GO:0045519	interleukin-23 receptor binding	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04625	C-type lectin receptor signaling pathway
hsa04659	Th17 cell differentiation
hsa05200	Pathways in cancer
hsa05323	Rheumatoid arthritis
hsa05321	Inflammatory bowel disease
hsa05133	Pertussis
hsa05152	Tuberculosis

Diseases

Associated diseases	References
Arthritis	GAD: 19034457
Psoriasis	GAD: 17236132
Crohn's disease	GAD: 17606463
Endometriosis	INFBASE: 22007253
Female infertility	INFBASE: 22007253
Ovarian hyperstimulation syndrome (OHSS)	INFBASE: 26823856
Male factor infertility	MIK: 21244563
Endometriosis-associated infertility	INFBASE: 21392744
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male Infertility	MIK: 21244563
May play a role during male gamete differentiation	MIK: 2223088
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21244563	Male infertility			57 (33 normal group, 24abnormal group, )	Male infertility	IL-23  IL-6 TNF-?
2223088	May play a role during male gamete differentiation				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R