• Gene id: 5156

Gene Summary

• Gene Symbol: PDGFRA   Gene   UCSC   Ensembl
• Aliases: CD140A, PDGFR-2, PDGFR2
• Gene name: platelet derived growth factor receptor alpha
• Alternate names: platelet-derived growth factor receptor alpha, CD140 antigen-like family member A, CD140a antigen, PDGF-R-alpha, alpha-type platelet-derived growth factor receptor, platelet-derived growth factor receptor 2, platelet-derived growth factor receptor, alpha polype,
• Gene location: 4q12 (54229126: 54298246)     Exons: 28     NC_000004.12
• Gene summary(Entrez): This gene encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines
• OMIM: 606023

Protein Summary

• Protein general information: P16234  
  • Name: Platelet derived growth factor receptor alpha (PDGF R alpha) (PDGFR alpha) (EC 2.7.10.1) (Alpha platelet derived growth factor receptor) (Alpha type platelet derived growth factor receptor) (CD140 antigen like family member A) (CD140a antigen) (Platelet d
  • Length: 1089  
  • Mass: 122670
  • Tissue specificity: Detected in platelets (at protein level). Widely expressed. Detected in brain, fibroblasts, smooth muscle, heart, and embryo. Expressed in primary and metastatic colon tumors and in normal colon tissue. {ECO
• Sequence:

  MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEE
  NNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPC
  RTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVY
  KSGETIVVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVK
  EMKKVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVRAYPPPRISWLKNNLTLIENLTEITTDVEKIQEIRY
  RSKLKLIRAKEEDSGHYTIVAQNEDAVKSYTFELLTQVPSSILDLVDDHHGSTGGQTVRCTAEGTPLPDIEWMIC
  KDIKKCNNETSWTILANNVSNIITEIHSRDRSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSEL
  TVAAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLG
  SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITE
  YCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSYVILSFENNGDYMDMKQADTTQYVPMLERKE
  VSKYSDIQRSLYDRPASYKKKSMLDSEVKNLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVL
  LAQGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
  VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFLKSDHP
  AVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAI
  ETGSSSSTFIKREDETIEDIDMMDDIGIDSSDLVEDSFL

• Structural information:
  • Protein Domains: (24..11-)
    1 (/note="Ig-like-C2-type)
    (117..20-)
    2 (/note="Ig-like-C2-type)
    (202..30-)
    3 (/note="Ig-like-C2-type)
    (319..41-)
    4 (/note="Ig-like-C2-type)
    (414..51-)
    5 (/note="Ig-like-C2-type)
    (593..95-)
    (/note="Protei-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013098  IPR003599   IPR003598  IPR011009  IPR027290  IPR000719  IPR017441  IPR001245  IPR008266  IPR020635  IPR001824  
  • Prosite: PS50835 PS00107 PS50011 PS00109 PS00240
  • PDB: 1GQ5 5GRN 5K5X 6A32
  • PDBsum: 1GQ5 5GRN 5K5X 6A32
  • DIP: 5736
  • STRING: ENSP00000257290
• Other Databases: GeneCards:  PDGFRA  Malacards:  PDGFRA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048701	embryonic cranial skeleton morphogenesis	IBA	biological process
GO:0043235	receptor complex	IBA	cellular component
GO:0033674	positive regulation of kinase activity	IBA	biological process
GO:0005018	platelet-derived growth factor alpha-receptor activity	IBA	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IBA	molecular function
GO:0048407	platelet-derived growth factor binding	IBA	molecular function
GO:0019838	growth factor binding	IBA	molecular function
GO:0007275	multicellular organism development	IBA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0002244	hematopoietic progenitor cell differentiation	IBA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0005018	platelet-derived growth factor alpha-receptor activity	IDA	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IDA	molecular function
GO:0048407	platelet-derived growth factor binding	IDA	molecular function
GO:0048407	platelet-derived growth factor binding	IDA	molecular function
GO:0031226	intrinsic component of plasma membrane	IDA	cellular component
GO:0010544	negative regulation of platelet activation	IDA	biological process
GO:0048701	embryonic cranial skeleton morphogenesis	ISS	biological process
GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity	IMP	biological process
GO:0042060	wound healing	ISS	biological process
GO:0035790	platelet-derived growth factor receptor-alpha signaling pathway	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	TAS	biological process
GO:0010863	positive regulation of phospholipase C activity	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0005018	platelet-derived growth factor alpha-receptor activity	IMP	molecular function
GO:0005794	Golgi apparatus	ISS	cellular component
GO:2000739	regulation of mesenchymal stem cell differentiation	IMP	biological process
GO:2000249	regulation of actin cytoskeleton reorganization	TAS	biological process
GO:0070527	platelet aggregation	IMP	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0060326	cell chemotaxis	IMP	biological process
GO:0050920	regulation of chemotaxis	IMP	biological process
GO:0048704	embryonic skeletal system morphogenesis	ISS	biological process
GO:0048557	embryonic digestive tract morphogenesis	ISS	biological process
GO:0048015	phosphatidylinositol-mediated signaling	IMP	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IMP	biological process
GO:0005929	cilium	ISS	cellular component
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0005018	platelet-derived growth factor alpha-receptor activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0034614	cellular response to reactive oxygen species	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0004672	protein kinase activity	IDA	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0051897	positive regulation of protein kinase B signaling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0072277	metanephric glomerular capillary formation	IEA	biological process
GO:0061298	retina vasculature development in camera-type eye	IEA	biological process
GO:0060326	cell chemotaxis	IEA	biological process
GO:0060021	roof of mouth development	IEA	biological process
GO:0048557	embryonic digestive tract morphogenesis	IEA	biological process
GO:0048407	platelet-derived growth factor binding	IEA	molecular function
GO:0048008	platelet-derived growth factor receptor signaling pathway	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0042475	odontogenesis of dentin-containing tooth	IEA	biological process
GO:0033327	Leydig cell differentiation	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0008210	estrogen metabolic process	IEA	biological process
GO:0005929	cilium	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0071230	cellular response to amino acid stimulus	IEA	biological process
GO:0060325	face morphogenesis	IEA	biological process
GO:0055003	cardiac myofibril assembly	IEA	biological process
GO:0048705	skeletal system morphogenesis	IEA	biological process
GO:0048701	embryonic cranial skeleton morphogenesis	IEA	biological process
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0035790	platelet-derived growth factor receptor-alpha signaling pathway	IEA	biological process
GO:0030539	male genitalia development	IEA	biological process
GO:0030325	adrenal gland development	IEA	biological process
GO:0023019	signal transduction involved in regulation of gene expression	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0016477	cell migration	IEA	biological process
GO:0009887	animal organ morphogenesis	IEA	biological process
GO:0009653	anatomical structure morphogenesis	IEA	biological process
GO:0008585	female gonad development	IEA	biological process
GO:0005902	microvillus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005018	platelet-derived growth factor alpha-receptor activity	IEA	molecular function
GO:0001553	luteinization	IEA	biological process
GO:0005018	platelet-derived growth factor alpha-receptor activity	IDA	molecular function
GO:0005018	platelet-derived growth factor alpha-receptor activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0005161	platelet-derived growth factor receptor binding	IPI	molecular function
GO:0038085	vascular endothelial growth factor binding	IPI	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0048407	platelet-derived growth factor binding	IPI	molecular function
GO:0048407	platelet-derived growth factor binding	IPI	molecular function
GO:0048407	platelet-derived growth factor binding	IPI	molecular function
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0038091	positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0048008	platelet-derived growth factor receptor signaling pathway	IDA	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	IDA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0001775	cell activation	TAS	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0055003	cardiac myofibril assembly	ISS	biological process
GO:0001553	luteinization	ISS	biological process
GO:0072277	metanephric glomerular capillary formation	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0061298	retina vasculature development in camera-type eye	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04144	Endocytosis
hsa05206	MicroRNAs in cancer
hsa04014	Ras signaling pathway
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa05163	Human cytomegalovirus infection
hsa04020	Calcium signaling pathway
hsa04510	Focal adhesion
hsa04072	Phospholipase D signaling pathway
hsa04630	JAK-STAT signaling pathway
hsa05231	Choline metabolism in cancer
hsa04540	Gap junction
hsa05215	Prostate cancer
hsa05214	Glioma
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa05218	Melanoma
hsa05230	Central carbon metabolism in cancer

Diseases

Associated diseases	References
Glioma	KEGG:H00042
Chronic eosinophilic leukemia	KEGG:H01590
Gastrotintestinal stromal tumor	KEGG:H01591
Hypereosinophilic syndrome	KEGG:H01599
Glioma	KEGG:H00042
Chronic eosinophilic leukemia	KEGG:H01590
Gastrotintestinal stromal tumor	KEGG:H01591
Hypereosinophilic syndrome	KEGG:H01599
medulloblastoma	PMID:25576913
leukemia	PMID:21224473
pancreatic cancer	PMID:7665222
pancreatic cancer	PMID:14695158
prostate adenocarcinoma	PMID:7524068
Leydig cell tumor	PMID:11920744
Leydig cell tumor	PMID:11994382
Breast carcinoma	PMID:16741576
Craniopharyngioma	PMID:20190664
Brain stem glioma	PMID:20197468
seminoma	PMID:8610136
renal cell carcinoma	PMID:12866380
Acute T cell leukemia	PMID:24486648
myeloid sarcoma	PMID:22348015
myeloid leukemia	PMID:24486648
in situ carcinoma	PMID:8610136
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881