• Gene id: 51554

Gene Summary

• Gene Symbol: ACKR4   Gene   UCSC   Ensembl
• Aliases: CC-CKR-11, CCBP2, CCR-11, CCR10, CCR11, CCRL1, CCX CKR, CCX-CKR, CKR-11, PPR1, VSHK1
• Gene name: atypical chemokine receptor 4
• Alternate names: atypical chemokine receptor 4, C-C CKR-11, C-C chemokine receptor type 11, CC chemokine receptor-like 1, chemocentryx chemokine receptor, chemokine (C-C motif) receptor-like 1, chemokine, cc motif, receptor-like protein 1, orphan seven-transmembrane receptor, ch,
• Gene location: 3q22.1 (132597269: 132602643)     Exons: 2     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the G protein-coupled receptor family, and is a receptor for C-C type chemokines. This receptor has been shown to bind dendritic cell- and T cell-activated chemokines including CCL19/ELC, CCL21/SLC, and CCL2
• OMIM: 606065

Protein Summary

• Protein general information: Q9NPB9  
  • Name: Atypical chemokine receptor 4 (C C chemokine receptor type 11) (C C CKR 11) (CC CKR 11) (CCR 11) (CC chemokine receptor like 1) (CCRL1) (CCX CKR)
  • Length: 350  
  • Mass: 39914
  • Tissue specificity: Predominantly expressed in heart. Lower expression in lung, pancreas, spleen, colon, skeletal muscle and small intestine. {ECO
• Sequence:

  MALEQNQSTDYYYEENEMNGTYDYSQYELICIKEDVREFAKVFLPVFLTIVFVIGLAGNSMVVAIYAYYKKQRTK
  TDVYILNLAVADLLLLFTLPFWAVNAVHGWVLGKIMCKITSALYTLNFVSGMQFLACISIDRYVAVTKVPSQSGV
  GKPCWIICFCVWMAAILLSIPQLVFYTVNDNARCIPIFPRYLGTSMKALIQMLEICIGFVVPFLIMGVCYFITAR
  TLMKMPNIKISRPLKVLLTVVIVFIVTQLPYNIVKFCRAIDIIYSLITSCNMSKRMDIAIQVTESIALFHSCLNP
  ILYVFMGASFKNYVMKVAKKYGSWRRQRQSVEEFPFDSEGPTEPTSTFSI

• Structural information:
  • Interpro: IPR005383  IPR000355  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • DIP: 5918
  • STRING: ENSP00000249887
• Other Databases: GeneCards:  ACKR4  Malacards:  ACKR4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019957	C-C chemokine binding	IBA	molecular function
GO:0060326	cell chemotaxis	IBA	biological process
GO:0019956	chemokine binding	IBA	molecular function
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0016493	C-C chemokine receptor activity	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0006935	chemotaxis	IBA	biological process
GO:0004950	chemokine receptor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004950	chemokine receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005044	scavenger receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019956	chemokine binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004950	chemokine receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006935	chemotaxis	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0055037	recycling endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)