• Gene id: 51552

Gene Summary

• Gene Symbol: RAB14   Gene   UCSC   Ensembl
• Aliases: FBP, RAB-14
• Gene name: RAB14, member RAS oncogene family
• Alternate names: ras-related protein Rab-14, F protein-binding protein 1, bA165P4.3 (member RAS oncogene family), small GTP binding protein RAB14,
• Gene location: 9q33.2 (121201868: 121178132)     Exons: 5     NC_000009.12
• Gene summary(Entrez): RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they
• OMIM: 612673

Protein Summary

• Protein general information: P61106  
  • Name: Ras related protein Rab 14
  • Length: 215  
  • Mass: 23897
• Sequence:

  MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRA
  VTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLF
  LEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC

• Structural information:
  • Interpro: IPR027417  IPR030702  IPR005225  IPR001806  
  • Prosite: PS51419
  • CDD: cd04122
  • PDB: 1Z0F 4D0G 4DRZ
  • PDBsum: 1Z0F 4D0G 4DRZ
  • DIP: 42491
  • STRING: ENSP00000362946
• Other Databases: GeneCards:  RAB14  Malacards:  RAB14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005769	early endosome	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0006895	Golgi to endosome transport	IBA	biological process
GO:0045335	phagocytic vesicle	IBA	cellular component
GO:0090387	phagolysosome assembly involved in apoptotic cell clearance	IBA	biological process
GO:0003924	GTPase activity	IBA	molecular function
GO:0012505	endomembrane system	IBA	cellular component
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0055037	recycling endosome	IDA	cellular component
GO:0032456	endocytic recycling	IDA	biological process
GO:0019003	GDP binding	IDA	molecular function
GO:0005525	GTP binding	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0045335	phagocytic vesicle	IDA	cellular component
GO:0032880	regulation of protein localization	IDA	biological process
GO:0045995	regulation of embryonic development	ISS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	ISS	biological process
GO:0006895	Golgi to endosome transport	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005802	trans-Golgi network	IEA	cellular component
GO:0032456	endocytic recycling	IEA	biological process
GO:0055037	recycling endosome	IEA	cellular component
GO:0090382	phagosome maturation	IEA	biological process
GO:0006895	Golgi to endosome transport	IEA	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0031901	early endosome membrane	TAS	cellular component
GO:0055038	recycling endosome membrane	TAS	cellular component
GO:0005622	intracellular	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045995	regulation of embryonic development	IEA	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0006895	Golgi to endosome transport	IEA	biological process
GO:0031901	early endosome membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0055037	recycling endosome	IEA	cellular component
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0003924	GTPase activity	IDA	molecular function
GO:0005929	cilium	IDA	NOT|cellular component
GO:0006895	Golgi to endosome transport	TAS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0046907	intracellular transport	NAS	biological process
GO:0016192	vesicle-mediated transport	NAS	biological process
GO:0005791	rough endoplasmic reticulum	ISS	cellular component
GO:0005765	lysosomal membrane	HDA	cellular component
GO:0005764	lysosome	ISS	cellular component
GO:0031489	myosin V binding	IPI	molecular function
GO:0042175	nuclear outer membrane-endoplasmic reticulum membrane network	ISS	cellular component
GO:0005770	late endosome	ISS	cellular component
GO:0005769	early endosome	ISS	cellular component
GO:0030140	trans-Golgi network transport vesicle	ISS	cellular component
GO:0005829	cytosol	ISS	cellular component
GO:0005795	Golgi stack	ISS	cellular component
GO:0003924	GTPase activity	NAS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04152	AMPK signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)