• Gene id: 5155

Gene Summary

• Gene Symbol: PDGFB   Gene   UCSC   Ensembl
• Aliases: IBGC5, PDGF-2, PDGF2, SIS, SSV, c-sis
• Gene name: platelet derived growth factor subunit B
• Alternate names: platelet-derived growth factor subunit B, PDGF subunit B, PDGF, B chain, becaplermin, epididymis secretory sperm binding protein, platelet-derived growth factor 2, platelet-derived growth factor B chain, platelet-derived growth factor beta polypeptide (simian sa,
• Gene location: 22q13.1 (93442335: 93405683)     Exons: 4     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor sub
• OMIM: 190040

Protein Summary

• Protein general information: P01127  
  • Name: Platelet derived growth factor subunit B (PDGF subunit B) (PDGF 2) (Platelet derived growth factor B chain) (Platelet derived growth factor beta polypeptide) (Proto oncogene c Sis) (Becaplermin)
  • Length: 241  
  • Mass: 27283
  • Tissue specificity: Expressed at high levels in the heart, brain (sustantia nigra), placenta and fetal kidney. Expressed at moderate levels in the brain (hippocampus), skeletal muscle, kidney and lung. {ECO
• Sequence:

  MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELES
  LARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRP
  VQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRK
  FKHTHDKTALKETLGA

• Structural information:
  • Interpro: IPR029034  IPR023581  IPR000072  IPR006782  IPR015583  
  • Prosite: PS00249 PS50278
  • CDD: cd00135
  • PDB: 1PDG 3MJG 4HQU 4HQX 4QCI
  • PDBsum: 1PDG 3MJG 4HQU 4HQX 4QCI
  • DIP: 5737
  • STRING: ENSP00000330382
• Other Databases: GeneCards:  PDGFB  Malacards:  PDGFB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043406	positive regulation of MAP kinase activity	IBA	biological process
GO:0031954	positive regulation of protein autophosphorylation	IBA	biological process
GO:0030335	positive regulation of cell migration	IBA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IBA	biological process
GO:0008284	positive regulation of cell population proliferation	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005161	platelet-derived growth factor receptor binding	IBA	molecular function
GO:0070851	growth factor receptor binding	IBA	molecular function
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	IBA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0005518	collagen binding	IDA	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0051897	positive regulation of protein kinase B signaling	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0010629	negative regulation of gene expression	IDA	biological process
GO:1902895	positive regulation of pri-miRNA transcription by RNA polymerase II	IDA	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	IDA	biological process
GO:1904754	positive regulation of vascular associated smooth muscle cell migration	IDA	biological process
GO:1904707	positive regulation of vascular smooth muscle cell proliferation	IDA	biological process
GO:1905064	negative regulation of vascular smooth muscle cell differentiation	IDA	biological process
GO:0005161	platelet-derived growth factor receptor binding	IDA	molecular function
GO:0005161	platelet-derived growth factor receptor binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0005161	platelet-derived growth factor receptor binding	IPI	molecular function
GO:0042056	chemoattractant activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0048407	platelet-derived growth factor binding	IPI	molecular function
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0009611	response to wounding	IDA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0043406	positive regulation of MAP kinase activity	IDA	biological process
GO:0043536	positive regulation of blood vessel endothelial cell migration	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0050921	positive regulation of chemotaxis	IDA	biological process
GO:0071363	cellular response to growth factor stimulus	IDA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IDA	biological process
GO:0002548	monocyte chemotaxis	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010512	negative regulation of phosphatidylinositol biosynthetic process	IDA	biological process
GO:0010544	negative regulation of platelet activation	IDA	biological process
GO:0014911	positive regulation of smooth muscle cell migration	IDA	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	IDA	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	IDA	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	IDA	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	IDA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0060326	cell chemotaxis	IDA	biological process
GO:0060326	cell chemotaxis	IDA	biological process
GO:1904707	positive regulation of vascular smooth muscle cell proliferation	IDA	biological process
GO:1904754	positive regulation of vascular associated smooth muscle cell migration	IDA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0035655	interleukin-18-mediated signaling pathway	IDA	biological process
GO:1902894	negative regulation of pri-miRNA transcription by RNA polymerase II	IDA	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	IDA	biological process
GO:0010629	negative regulation of gene expression	IDA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IDA	biological process
GO:1905176	positive regulation of vascular smooth muscle cell dedifferentiation	IDA	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0048661	positive regulation of smooth muscle cell proliferation	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0050918	positive chemotaxis	IEA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:1904707	positive regulation of vascular smooth muscle cell proliferation	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity	IDA	biological process
GO:0043406	positive regulation of MAP kinase activity	IDA	biological process
GO:0043406	positive regulation of MAP kinase activity	IDA	biological process
GO:0031954	positive regulation of protein autophosphorylation	IDA	biological process
GO:0031954	positive regulation of protein autophosphorylation	IDA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:2000591	positive regulation of metanephric mesenchymal cell migration	IDA	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IDA	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IDA	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IDA	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IDA	biological process
GO:0072126	positive regulation of glomerular mesangial cell proliferation	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0045840	positive regulation of mitotic nuclear division	IDA	biological process
GO:0045840	positive regulation of mitotic nuclear division	IDA	biological process
GO:0035793	positive regulation of metanephric mesenchymal cell migration by platelet-derived growth factor receptor-beta signaling pathway	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:1900127	positive regulation of hyaluronan biosynthetic process	IDA	biological process
GO:0090280	positive regulation of calcium ion import	IDA	biological process
GO:0050921	positive regulation of chemotaxis	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0043406	positive regulation of MAP kinase activity	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:1904754	positive regulation of vascular associated smooth muscle cell migration	IDA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IDA	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IDA	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IDA	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IDA	biological process
GO:0072126	positive regulation of glomerular mesangial cell proliferation	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0061098	positive regulation of protein tyrosine kinase activity	IDA	biological process
GO:0060326	cell chemotaxis	IDA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0045840	positive regulation of mitotic nuclear division	IDA	biological process
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	biological process
GO:0032148	activation of protein kinase B activity	IDA	biological process
GO:0032147	activation of protein kinase activity	IDA	biological process
GO:0016176	superoxide-generating NADPH oxidase activator activity	IDA	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0070528	protein kinase C signaling	IMP	biological process
GO:0016323	basolateral plasma membrane	ISS	cellular component
GO:0009611	response to wounding	NAS	biological process
GO:0005576	extracellular region	NAS	cellular component
GO:0072593	reactive oxygen species metabolic process	IMP	biological process
GO:0072255	metanephric glomerular mesangial cell development	ISS	biological process
GO:0071506	cellular response to mycophenolic acid	ISS	biological process
GO:0043410	positive regulation of MAPK cascade	IMP	biological process
GO:0030097	hemopoiesis	IMP	NOT|biological process
GO:0007507	heart development	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003104	positive regulation of glomerular filtration	ISS	biological process
GO:0038001	paracrine signaling	ISS	biological process
GO:0005161	platelet-derived growth factor receptor binding	NAS	molecular function
GO:0005737	cytoplasm	ISS	cellular component
GO:0001892	embryonic placenta development	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa05206	MicroRNAs in cancer
hsa04014	Ras signaling pathway
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa04510	Focal adhesion
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04072	Phospholipase D signaling pathway
hsa04630	JAK-STAT signaling pathway
hsa05418	Fluid shear stress and atherosclerosis
hsa05231	Choline metabolism in cancer
hsa04540	Gap junction
hsa05215	Prostate cancer
hsa05214	Glioma
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa05211	Renal cell carcinoma
hsa05218	Melanoma

Diseases

Associated diseases	References
Glioma	KEGG:H00042
Malignant pleural mesothelioma	KEGG:H00015
Familial idiopathic basal ganglia calcification	KEGG:H01574
Glioma	KEGG:H00042
Malignant pleural mesothelioma	KEGG:H00015
Familial idiopathic basal ganglia calcification	KEGG:H01574
Inflammatory bowel disease	PMID:11780721
Alzheimer's disease	PMID:22279551
Kuhnt-Junius degeneration	PMID:24334449
Prostatic hypertrophy	PMID:22689130
leiomyoma	PMID:16294022
Diabetic retinopathy	PMID:19799585
Diabetic retinopathy	PMID:19799585
Leydig cell tumor	PMID:11994382
Glioblastoma multiforme	PMID:21210235
Malignant glioma	PMID:27448842
Malignant glioma	PMID:26945107
Malignant glioma	PMID:21677873
Dermatofibrosarcoma protuberans	PMID:12641779
choriocarcinoma	PMID:8504434
clear cell renal cell carcinoma	PMID:25766258
clear cell renal cell carcinoma	PMID:23879920
Pulmonary hypertension	PMID:21819559
Rheumatoid arthritis	PMID:1708827
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881