• Gene id: 51548

Gene Summary

• Gene Symbol: SIRT6   Gene   UCSC   Ensembl
• Aliases: SIR2L6
• Gene name: sirtuin 6
• Alternate names: NAD-dependent protein deacetylase sirtuin-6, SIR2-like protein 6, regulatory protein SIR2 homolog 6, sir2-related protein type 6, sirtuin type 6,
• Gene location: 19p13.3 (4182562: 4174108)     Exons: 9     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the sirtuin family of NAD-dependent enzymes that are implicated in cellular stress resistance, genomic stability, aging and energy homeostasis. The encoded protein is localized to the nucleus, exhibits ADP-ribosyl transferase
• OMIM: 606212

Protein Summary

• Protein general information: Q8N6T7  
  • Name: NAD dependent protein deacetylase sirtuin 6 (EC 2.3.1.286) (Regulatory protein SIR2 homolog 6) (SIR2 like protein 6)
  • Length: 355  
  • Mass: 39119
• Sequence:

  MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEE
  RGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVR
  DTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNL
  PLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPK
  EESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS

• Structural information:
  • Protein Domains: (35..27-)
    (/note="Deacetylase-sirtuin-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00236"-)
  • Interpro: IPR029035  IPR003000  IPR026590  
  • Prosite: PS50305
  • PDB: 3K35 3PKI 3PKJ 3ZG6 5MF6 5MFP 5MFZ 5MGN 5X16 5Y2F 6HOY 6QCD 6QCE 6QCH 6QCJ
  • PDBsum: 3K35 3PKI 3PKJ 3ZG6 5MF6 5MFP 5MFZ 5MGN 5X16 5Y2F 6HOY 6QCD 6QCE 6QCH 6QCJ
  • DIP: 47346
  • STRING: ENSP00000337332
• Other Databases: GeneCards:  SIRT6  Malacards:  SIRT6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901485	positive regulation of transcription factor catabolic process	IMP	biological process
GO:0006476	protein deacetylation	IMP	biological process
GO:0004407	histone deacetylase activity	IBA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0019213	deacetylase activity	IBA	molecular function
GO:0046969	NAD-dependent histone deacetylase activity (H3-K9 specific)	IBA	molecular function
GO:0070932	histone H3 deacetylation	IBA	biological process
GO:0010569	regulation of double-strand break repair via homologous recombination	IDA	biological process
GO:0005730	nucleolus	IDA	NOT|cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0046969	NAD-dependent histone deacetylase activity (H3-K9 specific)	IDA	molecular function
GO:0070403	NAD+ binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0034979	NAD-dependent protein deacetylase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003247	post-embryonic cardiac muscle cell growth involved in heart morphogenesis	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0031648	protein destabilization	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0006476	protein deacetylation	IEA	biological process
GO:0006471	protein ADP-ribosylation	IEA	biological process
GO:0006284	base-excision repair	IEA	biological process
GO:0003956	NAD(P)+-protein-arginine ADP-ribosyltransferase activity	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0033558	protein deacetylase activity	IEA	molecular function
GO:0031667	response to nutrient levels	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:2000648	positive regulation of stem cell proliferation	IEA	biological process
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IEA	biological process
GO:0046969	NAD-dependent histone deacetylase activity (H3-K9 specific)	IEA	molecular function
GO:0046325	negative regulation of glucose import	IEA	biological process
GO:0045820	negative regulation of glycolytic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0003950	NAD+ ADP-ribosyltransferase activity	TAS	molecular function
GO:0006471	protein ADP-ribosylation	TAS	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0031940	positive regulation of chromatin silencing at telomere	IMP	biological process
GO:0032206	positive regulation of telomere maintenance	IMP	biological process
GO:0032206	positive regulation of telomere maintenance	IMP	biological process
GO:1905564	positive regulation of vascular endothelial cell proliferation	IMP	biological process
GO:1905555	positive regulation blood vessel branching	IMP	biological process
GO:1902732	positive regulation of chondrocyte proliferation	IMP	biological process
GO:1905549	positive regulation of subtelomeric heterochromatin assembly	IMP	biological process
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0099115	chromosome, subtelomeric region	IDA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0061647	histone H3-K9 modification	IEA	biological process
GO:0061647	histone H3-K9 modification	IEA	biological process
GO:0061647	histone H3-K9 modification	IEA	biological process
GO:1990619	histone H3-K9 deacetylation	IEA	biological process
GO:1990619	histone H3-K9 deacetylation	IEA	biological process
GO:1990619	histone H3-K9 deacetylation	IEA	biological process
GO:0017136	NAD-dependent histone deacetylase activity	ISS	molecular function
GO:0008270	zinc ion binding	ISS	molecular function
GO:0006471	protein ADP-ribosylation	ISS	biological process
GO:0070403	NAD+ binding	ISS	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0003956	NAD(P)+-protein-arginine ADP-ribosyltransferase activity	ISS	molecular function
GO:1901485	positive regulation of transcription factor catabolic process	IMP	biological process
GO:0006476	protein deacetylation	IMP	biological process
GO:0004407	histone deacetylase activity	IBA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0019213	deacetylase activity	IBA	molecular function
GO:0046969	NAD-dependent histone deacetylase activity (H3-K9 specific)	IBA	molecular function
GO:0070932	histone H3 deacetylation	IBA	biological process
GO:0010569	regulation of double-strand break repair via homologous recombination	IDA	biological process
GO:0005730	nucleolus	IDA	NOT|cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0046969	NAD-dependent histone deacetylase activity (H3-K9 specific)	IDA	molecular function
GO:0070403	NAD+ binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0034979	NAD-dependent protein deacetylase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003247	post-embryonic cardiac muscle cell growth involved in heart morphogenesis	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0031648	protein destabilization	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0006476	protein deacetylation	IEA	biological process
GO:0006471	protein ADP-ribosylation	IEA	biological process
GO:0006284	base-excision repair	IEA	biological process
GO:0003956	NAD(P)+-protein-arginine ADP-ribosyltransferase activity	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0033558	protein deacetylase activity	IEA	molecular function
GO:0031667	response to nutrient levels	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:2000648	positive regulation of stem cell proliferation	IEA	biological process
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IEA	biological process
GO:0046969	NAD-dependent histone deacetylase activity (H3-K9 specific)	IEA	molecular function
GO:0046325	negative regulation of glucose import	IEA	biological process
GO:0045820	negative regulation of glycolytic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0003950	NAD+ ADP-ribosyltransferase activity	TAS	molecular function
GO:0006471	protein ADP-ribosylation	TAS	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0031940	positive regulation of chromatin silencing at telomere	IMP	biological process
GO:0032206	positive regulation of telomere maintenance	IMP	biological process
GO:0032206	positive regulation of telomere maintenance	IMP	biological process
GO:1905564	positive regulation of vascular endothelial cell proliferation	IMP	biological process
GO:1905555	positive regulation blood vessel branching	IMP	biological process
GO:1902732	positive regulation of chondrocyte proliferation	IMP	biological process
GO:1905549	positive regulation of subtelomeric heterochromatin assembly	IMP	biological process
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0099115	chromosome, subtelomeric region	IDA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0061647	histone H3-K9 modification	IEA	biological process
GO:0061647	histone H3-K9 modification	IEA	biological process
GO:0061647	histone H3-K9 modification	IEA	biological process
GO:1990619	histone H3-K9 deacetylation	IEA	biological process
GO:1990619	histone H3-K9 deacetylation	IEA	biological process
GO:1990619	histone H3-K9 deacetylation	IEA	biological process
GO:0017136	NAD-dependent histone deacetylase activity	ISS	molecular function
GO:0008270	zinc ion binding	ISS	molecular function
GO:0006471	protein ADP-ribosylation	ISS	biological process
GO:0070403	NAD+ binding	ISS	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0003956	NAD(P)+-protein-arginine ADP-ribosyltransferase activity	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04714	Thermogenesis
hsa00760	Nicotinate and nicotinamide metabolism
hsa05230	Central carbon metabolism in cancer

Diseases

Associated diseases	References
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq