• Gene id: 51547

Gene Summary

• Gene Symbol: SIRT7   Gene   UCSC   Ensembl
• Aliases: SIR2L7
• Gene name: sirtuin 7
• Alternate names: NAD-dependent protein deacetylase sirtuin-7, NAD-dependent deacetylase sirtuin-7, NAD-dependent protein deacylase sirtuin-7, SIR2-like protein 7, regulatory protein SIR2 homolog 7, silent mating type information regulation 2, S.cerevisiae, homolog 7, sir2-relat,
• Gene location: 17q25.3 (81918175: 81911938)     Exons: 11     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been det
• OMIM: 602478

Protein Summary

• Protein general information: Q9NRC8  
  • Name: NAD dependent protein deacetylase sirtuin 7 (EC 2.3.1.286) (NAD dependent protein deacylase sirtuin 7) (EC 2.3.1. ) (Regulatory protein SIR2 homolog 7) (SIR2 like protein 7)
  • Length: 400  
  • Mass: 44898
• Sequence:

  MAAGGLSRSERKAAERVRRLREEQQRERLRQVSRILRKAAAERSAEEGRLLAESADLVTELQGRSRRREGLKRRQ
  EEVCDDPEELRGKVRELASAVRNAKYLVVYTGAGISTAASIPDYRGPNGVWTLLQKGRSVSAADLSEAEPTLTHM
  SITRLHEQKLVQHVVSQNCDGLHLRSGLPRTAISELHGNMYIEVCTSCVPNREYVRVFDVTERTALHRHQTGRTC
  HKCGTQLRDTIVHFGERGTLGQPLNWEAATEAASRADTILCLGSSLKVLKKYPRLWCMTKPPSRRPKLYIVNLQW
  TPKDDWAALKLHGKCDDVMRLLMAELGLEIPAYSRWQDPIFSLATPLRAGEEGSHSRKSLCRSREEAPPGDRGAP
  LSSAPILGGWFGRGCTKRTKRKKVT

• Structural information:
  • Protein Domains: (90..33-)
    (/note="Deacetylase-sirtuin-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00236"-)
  • Interpro: IPR029035  IPR003000  IPR026590  
  • Prosite: PS50305
  • PDB: 5IQZ 6G0S
  • PDBsum: 5IQZ 6G0S
  • DIP: 59906
  • STRING: ENSP00000329466
• Other Databases: GeneCards:  SIRT7  Malacards:  SIRT7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097372	NAD-dependent histone deacetylase activity (H3-K18 specific)	IBA	molecular function
GO:0004407	histone deacetylase activity	IBA	molecular function
GO:0070932	histone H3 deacetylation	IBA	biological process
GO:0019213	deacetylase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0062176	R-loop disassembly	IDA	biological process
GO:0034979	NAD-dependent protein deacetylase activity	IDA	molecular function
GO:0006476	protein deacetylation	IDA	biological process
GO:0097372	NAD-dependent histone deacetylase activity (H3-K18 specific)	IDA	molecular function
GO:0097372	NAD-dependent histone deacetylase activity (H3-K18 specific)	IDA	molecular function
GO:1990258	histone glutamine methylation	IDA	biological process
GO:0034979	NAD-dependent protein deacetylase activity	IDA	molecular function
GO:0006476	protein deacetylation	IDA	biological process
GO:0031397	negative regulation of protein ubiquitination	IDA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0034979	NAD-dependent protein deacetylase activity	IDA	molecular function
GO:0006476	protein deacetylation	IDA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0034979	NAD-dependent protein deacetylase activity	IDA	molecular function
GO:0006476	protein deacetylation	IDA	biological process
GO:0034979	NAD-dependent protein deacetylase activity	IDA	molecular function
GO:0006476	protein deacetylation	IDA	biological process
GO:0034979	NAD-dependent protein deacetylase activity	IDA	molecular function
GO:0006476	protein deacetylation	IDA	biological process
GO:0034979	NAD-dependent protein deacetylase activity	IDA	molecular function
GO:0006476	protein deacetylation	IDA	biological process
GO:0097372	NAD-dependent histone deacetylase activity (H3-K18 specific)	IDA	molecular function
GO:0097372	NAD-dependent histone deacetylase activity (H3-K18 specific)	IDA	molecular function
GO:0061697	protein-glutaryllysine deglutarylase activity	IDA	molecular function
GO:0034979	NAD-dependent protein deacetylase activity	IDA	molecular function
GO:1901836	regulation of transcription of nucleolar large rRNA by RNA polymerase I	IDA	biological process
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0006476	protein deacetylation	IDA	biological process
GO:0016570	histone modification	IDA	biological process
GO:0036049	peptidyl-lysine desuccinylation	IDA	biological process
GO:0097372	NAD-dependent histone deacetylase activity (H3-K18 specific)	IDA	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0003682	chromatin binding	IDA	molecular function
GO:0070932	histone H3 deacetylation	IDA	biological process
GO:0070932	histone H3 deacetylation	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:2000234	positive regulation of rRNA processing	IDA	biological process
GO:0006282	regulation of DNA repair	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0000785	chromatin	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0070932	histone H3 deacetylation	IDA	biological process
GO:0070932	histone H3 deacetylation	IDA	biological process
GO:0061698	protein deglutarylation	IDA	biological process
GO:0035861	site of double-strand break	IDA	cellular component
GO:0006282	regulation of DNA repair	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0036055	protein-succinyllysine desuccinylase activity	IDA	molecular function
GO:0070932	histone H3 deacetylation	IDA	biological process
GO:0005731	nucleolus organizer region	IDA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0010821	regulation of mitochondrion organization	IMP	biological process
GO:0007129	synapsis	ISS	biological process
GO:0106231	protein-propionyllysine depropionylase activity	ISS	molecular function
GO:0046825	regulation of protein export from nucleus	ISS	biological process
GO:0010821	regulation of mitochondrion organization	ISS	biological process
GO:0010529	negative regulation of transposition	ISS	biological process
GO:0001649	osteoblast differentiation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006111	regulation of gluconeogenesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2001032	regulation of double-strand break repair via nonhomologous end joining	ISS	biological process
GO:0106230	protein depropionylation	ISS	biological process
GO:0009303	rRNA transcription	IMP	biological process
GO:0007072	positive regulation of transcription involved in exit from mitosis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070403	NAD+ binding	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0106231	protein-propionyllysine depropionylase activity	IEA	molecular function
GO:0097372	NAD-dependent histone deacetylase activity (H3-K18 specific)	IEA	molecular function
GO:0046825	regulation of protein export from nucleus	IEA	biological process
GO:0034979	NAD-dependent protein deacetylase activity	IEA	molecular function
GO:0010821	regulation of mitochondrion organization	IEA	biological process
GO:0010529	negative regulation of transposition	IEA	biological process
GO:0007129	synapsis	IEA	biological process
GO:0006476	protein deacetylation	IEA	biological process
GO:0001649	osteoblast differentiation	IEA	biological process
GO:2001032	regulation of double-strand break repair via nonhomologous end joining	IEA	biological process
GO:0106230	protein depropionylation	IEA	biological process
GO:0070932	histone H3 deacetylation	IEA	biological process
GO:0035861	site of double-strand break	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0000785	chromatin	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0070933	histone H4 deacetylation	IEA	biological process
GO:0070933	histone H4 deacetylation	IEA	biological process
GO:0070933	histone H4 deacetylation	IEA	biological process
GO:0070933	histone H4 deacetylation	IEA	biological process
GO:0070933	histone H4 deacetylation	IEA	biological process
GO:0070933	histone H4 deacetylation	IEA	biological process
GO:0070933	histone H4 deacetylation	IEA	biological process
GO:0061699	peptidyl-lysine deglutarylation	IEA	biological process
GO:0097372	NAD-dependent histone deacetylase activity (H3-K18 specific)	IBA	molecular function
GO:0004407	histone deacetylase activity	IBA	molecular function
GO:0070932	histone H3 deacetylation	IBA	biological process
GO:0019213	deacetylase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0062176	R-loop disassembly	IDA	biological process
GO:0034979	NAD-dependent protein deacetylase activity	IDA	molecular function
GO:0006476	protein deacetylation	IDA	biological process
GO:0097372	NAD-dependent histone deacetylase activity (H3-K18 specific)	IDA	molecular function
GO:0097372	NAD-dependent histone deacetylase activity (H3-K18 specific)	IDA	molecular function
GO:1990258	histone glutamine methylation	IDA	biological process
GO:0034979	NAD-dependent protein deacetylase activity	IDA	molecular function
GO:0006476	protein deacetylation	IDA	biological process
GO:0031397	negative regulation of protein ubiquitination	IDA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0034979	NAD-dependent protein deacetylase activity	IDA	molecular function
GO:0006476	protein deacetylation	IDA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0034979	NAD-dependent protein deacetylase activity	IDA	molecular function
GO:0006476	protein deacetylation	IDA	biological process
GO:0034979	NAD-dependent protein deacetylase activity	IDA	molecular function
GO:0006476	protein deacetylation	IDA	biological process
GO:0034979	NAD-dependent protein deacetylase activity	IDA	molecular function
GO:0006476	protein deacetylation	IDA	biological process
GO:0034979	NAD-dependent protein deacetylase activity	IDA	molecular function
GO:0006476	protein deacetylation	IDA	biological process
GO:0097372	NAD-dependent histone deacetylase activity (H3-K18 specific)	IDA	molecular function
GO:0097372	NAD-dependent histone deacetylase activity (H3-K18 specific)	IDA	molecular function
GO:0061697	protein-glutaryllysine deglutarylase activity	IDA	molecular function
GO:0034979	NAD-dependent protein deacetylase activity	IDA	molecular function
GO:1901836	regulation of transcription of nucleolar large rRNA by RNA polymerase I	IDA	biological process
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0006476	protein deacetylation	IDA	biological process
GO:0016570	histone modification	IDA	biological process
GO:0036049	peptidyl-lysine desuccinylation	IDA	biological process
GO:0097372	NAD-dependent histone deacetylase activity (H3-K18 specific)	IDA	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0003682	chromatin binding	IDA	molecular function
GO:0070932	histone H3 deacetylation	IDA	biological process
GO:0070932	histone H3 deacetylation	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:2000234	positive regulation of rRNA processing	IDA	biological process
GO:0006282	regulation of DNA repair	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0000785	chromatin	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0070932	histone H3 deacetylation	IDA	biological process
GO:0070932	histone H3 deacetylation	IDA	biological process
GO:0061698	protein deglutarylation	IDA	biological process
GO:0035861	site of double-strand break	IDA	cellular component
GO:0006282	regulation of DNA repair	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0036055	protein-succinyllysine desuccinylase activity	IDA	molecular function
GO:0070932	histone H3 deacetylation	IDA	biological process
GO:0005731	nucleolus organizer region	IDA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0010821	regulation of mitochondrion organization	IMP	biological process
GO:0007129	synapsis	ISS	biological process
GO:0106231	protein-propionyllysine depropionylase activity	ISS	molecular function
GO:0046825	regulation of protein export from nucleus	ISS	biological process
GO:0010821	regulation of mitochondrion organization	ISS	biological process
GO:0010529	negative regulation of transposition	ISS	biological process
GO:0001649	osteoblast differentiation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006111	regulation of gluconeogenesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2001032	regulation of double-strand break repair via nonhomologous end joining	ISS	biological process
GO:0106230	protein depropionylation	ISS	biological process
GO:0009303	rRNA transcription	IMP	biological process
GO:0007072	positive regulation of transcription involved in exit from mitosis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070403	NAD+ binding	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0106231	protein-propionyllysine depropionylase activity	IEA	molecular function
GO:0097372	NAD-dependent histone deacetylase activity (H3-K18 specific)	IEA	molecular function
GO:0046825	regulation of protein export from nucleus	IEA	biological process
GO:0034979	NAD-dependent protein deacetylase activity	IEA	molecular function
GO:0010821	regulation of mitochondrion organization	IEA	biological process
GO:0010529	negative regulation of transposition	IEA	biological process
GO:0007129	synapsis	IEA	biological process
GO:0006476	protein deacetylation	IEA	biological process
GO:0001649	osteoblast differentiation	IEA	biological process
GO:2001032	regulation of double-strand break repair via nonhomologous end joining	IEA	biological process
GO:0106230	protein depropionylation	IEA	biological process
GO:0070932	histone H3 deacetylation	IEA	biological process
GO:0035861	site of double-strand break	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0000785	chromatin	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0070933	histone H4 deacetylation	IEA	biological process
GO:0070933	histone H4 deacetylation	IEA	biological process
GO:0070933	histone H4 deacetylation	IEA	biological process
GO:0070933	histone H4 deacetylation	IEA	biological process
GO:0070933	histone H4 deacetylation	IEA	biological process
GO:0070933	histone H4 deacetylation	IEA	biological process
GO:0070933	histone H4 deacetylation	IEA	biological process
GO:0061699	peptidyl-lysine deglutarylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00760	Nicotinate and nicotinamide metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray