• Gene id: 51540

Gene Summary

• Gene Symbol: SCLY   Gene   UCSC   Ensembl
• Aliases: SCL, hSCL
• Gene name: selenocysteine lyase
• Alternate names: selenocysteine lyase,
• Gene location: 2q37.3 (238061000: 238099412)     Exons: 12     NC_000002.12
• Gene summary(Entrez): Selenocysteine lyase (SCLY; EC 4.4.1.16) catalyzes the pyridoxal 5-prime phosphate-dependent conversion of L-selenocysteine to L-alanine and elemental selenium (Mihara et al., 2000 [PubMed 10692412]).[supplied by OMIM, Mar 2008]
• OMIM: 602307

Protein Summary

• Protein general information: Q96I15  
  • Name: Selenocysteine lyase (hSCL) (EC 4.4.1.16)
  • Length: 445  
  • Mass: 48149
• Sequence:

  MEAAVAPGRDAPAPAASQPSGCGKHNSPERKVYMDYNATTPLEPEVIQAMTKAMWEAWGNPSSPYSAGRKAKDII
  NAARESLAKMIGGKPQDIIFTSGGTESNNLVIHSVVKHFHANQTSKGHTGGHHSPVKGAKPHFITSSVEHDSIRL
  PLEHLVEEQVAAVTFVPVSKVSGQAEVDDILAAVRPTTRLVTIMLANNETGIVMPVPEISQRIKALNQERVAAGL
  PPILVHTDAAQALGKQRVDVEDLGVDFLTIVGHKFYGPRIGALYIRGLGEFTPLYPMLFGGGQERNFRPGTENTP
  MIAGLGKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNSQFPGTQRLPNTCNFSIRGPRLQGHVVLA
  QCRVLMASVGAACHSDHGDQPSPVLLSYGVPFDVARNALRLSVGRSTTRAEVDLVVQDLKQAVAQLEDQA

• Structural information:
  • Interpro: IPR000192  IPR016454  IPR015424  IPR015422  IPR015421  
  • PDB: 3GZC 3GZD
  • PDBsum: 3GZC 3GZD
  • STRING: ENSP00000254663
• Other Databases: GeneCards:  SCLY  Malacards:  SCLY

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003824	catalytic activity	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0009000	selenocysteine lyase activity	TAS	molecular function
GO:0006520	cellular amino acid metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0009000	selenocysteine lyase activity	IEA	molecular function
GO:0001887	selenium compound metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00450	Selenocompound metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray