• Gene id: 51530

Gene Summary

• Gene Symbol: ZC3HC1   Gene   UCSC   Ensembl
• Aliases: HSPC216, NIPA
• Gene name: zinc finger C3HC-type containing 1
• Alternate names: nuclear-interacting partner of ALK, hematopoietic stem/progenitor cell protein 216, nuclear interacting partner of anaplastic lymphoma kinase (ALK),
• Gene location: 7q32.2 (130051450: 130018285)     Exons: 14     NC_000007.14
• Gene summary(Entrez): This gene encodes an F-box-containing protein that is a component of an SCF-type E3 ubiquitin ligase complex that regulates the onset of cell division. The G2/M transition in the cell cycle requires the interaction of the proteins cyclin B1 and cyclin-dep
• OMIM: 605005

Protein Summary

• Protein general information: Q86WB0  
  • Name: Nuclear interacting partner of ALK (Nuclear interacting partner of anaplastic lymphoma kinase) (hNIPA) (Zinc finger C3HC type protein 1)
  • Length: 502  
  • Mass: 55262
  • Tissue specificity: Widely expressed. Highly expressed in heart, skeletal muscle and testis. Expressed in brain, placenta, lung, kidney, liver, pancreas, spleen, thymus, prostate, ovary small intestine and colon. Weakly or not expressed in leukocytes. {EC
• Sequence:

  MAAPCEGQAFAVGVEKNWGAVVRSPEGTPQKIRQLIDEGIAPEEGGVDAKDTSATSQSVNGSPQAEQPSLESTSK
  EAFFSRVETFSSLKWAGKPFELSPLVCAKYGWVTVECDMLKCSSCQAFLCASLQPAFDFDRYKQRCAELKKALCT
  AHEKFCFWPDSPSPDRFGMLPLDEPAILVSEFLDRFQSLCHLDLQLPSLRPEDLKTMCLTEDKISLLLHLLEDEL
  DHRTDERKTTIKLGSDIQVHVTACILSVCGWACSSSLESMQLSLITCSQCMRKVGLWGFQQIESSMTDLDASFGL
  TSSPIPGLEGRPERLPLVPESPRRMMTRSQDATFSPGSEQAEKSPGPIVSRTRSWDSSSPVDRPEPEAASPTTRT
  RPVTRSMGTGDTPGLEVPSSPLRKAKRARLCSSSSSDTSSRSFFDPTSQHRDWCPWVNITLGKESRENGGTEPDA
  SAPAEPGWKAVLTILLAHKQSSQPAETDSMSLSEKSRKVFRIFRQWESLCSC

• Structural information:
  • Interpro: IPR013909  IPR012935  
  • STRING: ENSP00000351052
• Other Databases: GeneCards:  ZC3HC1  Malacards:  ZC3HC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0042025	host cell nucleus	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:2001240	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R