• Gene id: 51527

Gene Summary

• Gene Symbol: GSKIP   Gene   UCSC   Ensembl
• Aliases: C14orf129, HSPC210
• Gene name: GSK3B interacting protein
• Alternate names: GSK3B-interacting protein, GSK3-beta interaction protein,
• Gene location: 14q32.2 (160400096: 160393147)     Exons: 3     NC_000005.10
• Gene summary(Entrez): This gene encodes a protein that is involved as a negative regulator of GSK3-beta in the Wnt signaling pathway. The encoded protein may play a role in the retinoic acid signaling pathway by regulating the functional interactions between GSK3-beta, beta-ca
• OMIM: 616605

Protein Summary

• Protein general information: Q9P0R6  
  • Name: GSK3B interacting protein (GSKIP) (GSK3beta interaction protein)
  • Length: 139  
  • Mass: 15648
  • Tissue specificity: Detected in heart, brain, placenta, liver, skeletal muscle, kidney, testis, lung and pancreas. {ECO
• Sequence:

  METDCNPMELSSMSGFEEGSELNGFEGTDMKDMRLEAEAVVNDVLFAVNNMFVSKSLRCADDVAYINVETKERNR
  YCLELTEAGLKVVGYAFDQVDDHLQTPYHETVYSLLDTLSPAYREAFGNALLQRLEALKRDGQS

• Structural information:
  • Interpro: IPR037395  IPR007967  IPR023231  
  • PDB: 1SGO
  • PDBsum: 1SGO
  • STRING: ENSP00000451188
• Other Databases: GeneCards:  GSKIP  Malacards:  GSKIP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0019207	kinase regulator activity	IBA	molecular function
GO:0030111	regulation of Wnt signaling pathway	IBA	biological process
GO:0051018	protein kinase A binding	IBA	molecular function
GO:0090263	positive regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0008013	beta-catenin binding	IDA	NOT|molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0004860	protein kinase inhibitor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051018	protein kinase A binding	IPI	molecular function
GO:0051018	protein kinase A binding	IPI	molecular function
GO:0034237	protein kinase A regulatory subunit binding	IPI	molecular function
GO:0008631	intrinsic apoptotic signaling pathway in response to oxidative stress	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060828	regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006469	negative regulation of protein kinase activity	IMP	biological process
GO:0004860	protein kinase inhibitor activity	IMP	molecular function
GO:0030111	regulation of Wnt signaling pathway	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R