• Gene id: 51524

Gene Summary

• Gene Symbol: TMEM138   Gene   UCSC   Ensembl
• Aliases: HSPC196
• Gene name: transmembrane protein 138
• Alternate names: transmembrane protein 138,
• Gene location: 11q12.2 (61362360: 61378223)     Exons: 8     NC_000011.10
• Gene summary(Entrez): This gene encodes a multi-pass transmembrane protein. Reduced expression of this gene in mouse fibroblasts causes short cilia and failure of ciliogenesis. Expression of this gene is tightly coordinated with expression of the neighboring gene TMEM216. Muta
• OMIM: 608163

Protein Summary

• Protein general information: Q9NPI0  
  • Name: Transmembrane protein 138
  • Length: 162  
  • Mass: 19262
• Sequence:

  MLQTSNYSLVLSLQFLLLSYDLFVNSFSELLQKTPVIQLVLFIIQDIAVLFNIIIIFLMFFNTFVFQAGLVNLLF
  HKFKGTIILTAVYFALSISLHVWVMNLRWKNSNSFIWTDGLQMLFVFQRLAAVLYCYFYKRTAVRLGDPHFYQDS
  LWLRKEFMQVRR

• Structural information:
  • Interpro: IPR024133  
  • STRING: ENSP00000278826
• Other Databases: GeneCards:  TMEM138  Malacards:  TMEM138

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005929	cilium	IBA	cellular component
GO:0005929	cilium	IDA	cellular component
GO:0060271	cilium assembly	IMP	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005773	vacuole	IEA	cellular component
GO:0030030	cell projection organization	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005774	vacuolar membrane	IEA	cellular component

Diseases

Associated diseases	References
Joubert syndrome	KEGG:H00530
Joubert syndrome	KEGG:H00530
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881