• Gene id: 51512

Gene Summary

• Gene Symbol: GTSE1   Gene   UCSC   Ensembl
• Aliases: B99
• Gene name: G2 and S-phase expressed 1
• Alternate names: G2 and S phase-expressed protein 1, G-2 and S-phase expressed 1, protein B99 homolog,
• Gene location: 22q13.31 (46295142: 46333698)     Exons: 14     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene is only expressed in the S and G2 phases of the cell cycle, where it colocalizes with cytoplasmic tubulin and microtubules. In response to DNA damage, the encoded protein accumulates in the nucleus and binds the tumor supp
• OMIM: 607477

Protein Summary

• Protein general information: Q9NYZ3  
  • Name: G2 and S phase expressed protein 1 (GTSE 1) (Protein B99 homolog)
  • Length: 720  
  • Mass: 76645
• Sequence:

  MDDPKKEDILLLADEKFDFDLSLSSSSANEDDEVFFGPFGHKERCIAASLELNNPVPEQPPLPTSESPFAWSPLA
  GEKFVEVYKEAHLLALHIESSSRNQAAQAAKPEDPRSQGVERFIQESKLKINLFEKEKEMKKSPTSLKRETYYLS
  DSPLLGPPVGEPRLLASSPALPSSGAQARLTRAPGPPHSAHALPRESCTAHAASQAATQRKPGTKLLLPRAASVR
  GRSIPGAAEKPKKEIPASPSRTKIPAEKESHRDVLPDKPAPGAVNVPAAGSHLGQGKRAIPVPNKLGLKKTLLKA
  PGSTSNLARKSSSGPVWSGASSACTSPAVGKAKSSEFASIPANSSRPLSNISKSGRMGPAMLRPALPAGPVGASS
  WQAKRVDVSELAAEQLTAPPSASPTQPQTPEGGGQWLNSSCAWSESSQLNKTRSIRRRDSCLNSKTKVMPTPTNQ
  FKIPKFSIGDSPDSSTPKLSRAQRPQSCTSVGRVTVHSTPVRRSSGPAPQSLLSAWRVSALPTPASRRCSGLPPM
  TPKTMPRAVGSPLCVPARRRSSEPRKNSAMRTEPTRESNRKTDSRLVDVSPDRGSPPSRVPQALNFSPEESDSTF
  SKSTATEVAREEAKPGGDAAPSEALLVDIKLEPLAVTPDAASQPLIDLPLIDFCDTPEAHVAVGSESRPLIDLMT
  NTPDMNKNVAKPSPVVGQLIDLSSPLIQLSPEADKENVDSPLLKF

• Structural information:
  • Interpro: IPR026657  IPR026659  IPR032768  
  • PDB: 6QNN 6QNP
  • PDBsum: 6QNN 6QNP
  • STRING: ENSP00000415430
• Other Databases: GeneCards:  GTSE1  Malacards:  GTSE1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005874	microtubule	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:1900182	positive regulation of protein localization to nucleus	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030335	positive regulation of cell migration	TAS	biological process
GO:0046827	positive regulation of protein export from nucleus	TAS	biological process
GO:0050821	protein stabilization	TAS	biological process
GO:1902749	regulation of cell cycle G2/M phase transition	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005881	cytoplasmic microtubule	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0007017	microtubule-based process	NAS	biological process
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04115	p53 signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq